DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7094 and tptep2-csnk1e

DIOPT Version :9

Sequence 1:NP_609851.2 Gene:CG7094 / 35065 FlyBaseID:FBgn0032650 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_012816439.1 Gene:tptep2-csnk1e / 496553 XenbaseID:XB-GENE-481480 Length:445 Species:Xenopus tropicalis


Alignment Length:408 Identity:193/408 - (47%)
Similarity:252/408 - (61%) Gaps:59/408 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KLLIGGKYRLVKPIGSGSFGDIYLGLSITDGSEVAIKVEKNDAKYPQLIYEAKVYEQLARCPGFP 84
            :|.:|.||||.:.||||||||||||.:|..|.|||||:|....|:|||..|:|.|:.:....|.|
 Frog    31 ELRVGNKYRLGRKIGSGSFGDIYLGANIATGEEVAIKLECVKTKHPQLHIESKFYKMMQGGVGIP 95

  Fly    85 TLLHYGCEKNYNAMVMDLLGPSLEELFNLCKRRFSLKTVLMLTDQLLMRIECVHERGFIHRDIKP 149
            ::...|.|.:||.|||:|||||||:|||.|.|:|||||||:|.||::.|||.:|.:.|||||:||
 Frog    96 SIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKP 160

  Fly   150 DNFLMGLDRHCNKLYLIDFGLSKRYKDIESEIHIPYRTDRNLTGTVRYASINAQIGVEQSRRDDM 214
            |||||||.:..|.:|:|||||:|:|:|..:..|||||.::|||||.||||||..:|:|||||||:
 Frog   161 DNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDL 225

  Fly   215 ESMSYCLMYFNLGKLPWQGITAANKKQKYEKILEKKTSVTIAQLCKGFPSEFCLLMTYVRNLGFK 279
            ||:.|.|||||||.|||||:.||.|:||||:|.|||.|..|..||||:||||...:.:.|:|.|.
 Frog   226 ESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFSTYLNFCRSLRFD 290

  Fly   280 EPPDHTYLRQIFRILFRSLNHHYDYIYDWTALQ----QQKDQICRSREQILESEREEVRKRDGE- 339
            :.||::||||:||.||......|||::||..|:    :..:.:.|.|.   |.:|||   |.|: 
 Frog   291 DKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGAARNPEDLDRERR---EHDREE---RMGQL 349

  Fly   340 -------------RGCEPQR------------------------------DKERHKDLELDRLHK 361
                         .|..|.|                              |:||...:   |||:
 Frog   350 RGSATRALPPGPPAGAAPNRLRNGGEPVASTPASRIQQSGNTSPRAISRVDRERKVSM---RLHR 411

  Fly   362 TSTQQAKCSNGHLTNRYD 379
            .:  .|..|:..||.|.:
 Frog   412 GA--PANVSSSDLTGRQE 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7094NP_609851.2 STKc_CK1 26..291 CDD:270918 159/264 (60%)
SPS1 26..>266 CDD:223589 148/239 (62%)
tptep2-csnk1eXP_012816439.1 STKc_CK1_delta_epsilon 37..311 CDD:271027 163/273 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 1 1.000 - - FOG0000297
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.