DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7094 and Asator

DIOPT Version :9

Sequence 1:NP_609851.2 Gene:CG7094 / 35065 FlyBaseID:FBgn0032650 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_651924.2 Gene:Asator / 43794 FlyBaseID:FBgn0039908 Length:1349 Species:Drosophila melanogaster


Alignment Length:308 Identity:107/308 - (34%)
Similarity:161/308 - (52%) Gaps:36/308 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 EKLLIGG-----KYRLVKPIGSGSFGDIYLGLSITDGSEVAIKVEKNDAKYPQLIYEAKVYEQLA 78
            |.||..|     ::::|:.||.|.||:||.|..:....:||:|||  .|:.|:.:.:.:| ..|.
  Fly   160 EDLLQPGHVVKERWKVVRKIGGGGFGEIYEGQDLITREQVALKVE--SARQPKQVLKMEV-AVLK 221

  Fly    79 RCPGFPTLLHY-GCEKN--YNAMVMDLLGPSLEELFNLCKR-RFSLKTVLMLTDQLLMRIECVHE 139
            :..|...:..: ||.:|  :|.:||.|.|.:|.||.....| .|||.|.|.|..|:|..||.:|.
  Fly   222 KLQGKEHVCRFIGCGRNDRFNYVVMQLQGKNLAELRRAQPRGAFSLSTTLRLGLQILKAIESIHS 286

  Fly   140 RGFIHRDIKPDNFLMG-LDRHCNKLYLIDFGLSKRYKDIESEIHIPYRTDRNLTGTVRYASINAQ 203
            .||:||||||.||.:| |..:|.::|::||||:::|.....|:..| |......||||||||||.
  Fly   287 VGFLHRDIKPSNFSVGRLPYNCRRVYMLDFGLARQYTTGTGEVRCP-RAAAGFRGTVRYASINAH 350

  Fly   204 IGVEQSRRDDMESMSYCLMYFNLGKLPWQ--------GITAANKKQKYEKILEKKTSVTIAQLCK 260
            ...|..|.||:.|:.|.|:.|..|:|||:        |:|    |:||:..:          |.|
  Fly   351 RNREMGRHDDLWSLFYMLVEFVNGQLPWRKIKDKEQVGLT----KEKYDHRI----------LLK 401

  Fly   261 GFPSEFCLLMTYVRNLGFKEPPDHTYLRQIFRILFRSLNHHYDYIYDW 308
            ..||:....:.::::|.:.:.||:..|..:|....:.........|||
  Fly   402 HLPSDLKQFLEHIQSLTYGDRPDYAMLIGLFERCMKRRGVKESDPYDW 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7094NP_609851.2 STKc_CK1 26..291 CDD:270918 99/277 (36%)
SPS1 26..>266 CDD:223589 95/252 (38%)
AsatorNP_651924.2 STKc_TTBK 172..433 CDD:270919 99/278 (36%)
S_TKc 173..414 CDD:214567 95/258 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452731
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11909
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.