DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7094 and ball

DIOPT Version :9

Sequence 1:NP_609851.2 Gene:CG7094 / 35065 FlyBaseID:FBgn0032650 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster


Alignment Length:391 Identity:96/391 - (24%)
Similarity:156/391 - (39%) Gaps:74/391 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVRNASLHLEKLLIGGKYRLVKPIGSGSFGDIYLGLSITDGS-EVAIKVEKNDAKYPQLIYEAKV 73
            ||:..::..:  |..|::|:...||.|.||:||....:.:.: :..:|.|.: ...| |..|...
  Fly    32 KVKEGTVFTD--LAKGQWRIGPSIGVGGFGEIYAACKVGEKNYDAVVKCEPH-GNGP-LFVEMHF 92

  Fly    74 YEQLARCP--------------GFPTLLHYG-CEKN---YNAMVMDLLGPSLEELFNLCKRRFSL 120
            |.:.|:..              |.|.:|..| .|.|   :..:||...|..|.:......:|...
  Fly    93 YLRNAKLEDIKQFMQKHGLKSLGMPYILANGSVEVNGEKHRFIVMPRYGSDLTKFLEQNGKRLPE 157

  Fly   121 KTVLMLTDQLLMRIECVHERGFIHRDIKPDNFLMGLDR-HCNKLYLIDFGLSKR-----YKDIES 179
            .||..|..|:|...:.:|..|::|.|:|..|.|:||:: ...:.||:||||:..     :|....
  Fly   158 GTVYRLAIQMLDVYQYMHSNGYVHADLKAANILLGLEKGGAAQAYLVDFGLASHFVTGDFKPDPK 222

  Fly   180 EIHIPYRTDRNLTGTVRYASINAQIGVEQSRRDDMESMSYCLMYFNLGKLPW--QGITAANKK-Q 241
            ::|         .||:.|.|.:|.:|| .:||.|:|.:.|.|:.:...:|||  |.:.|...| |
  Fly   223 KMH---------NGTIEYTSRDAHLGV-PTRRADLEILGYNLIEWLGAELPWVTQKLLAVPPKVQ 277

  Fly   242 KYEKILEKKTSVTIAQLC-KGFPSEFCLLMTYVRNLGFKEPPDHTYLRQIFRILFRSL----NHH 301
            |.::........::..|. ||.|......|.||..|...:.||:...|..|....:.|    |..
  Fly   278 KAKEAFMDNIGESLKTLFPKGVPPPIGDFMKYVSKLTHNQEPDYDKCRSWFSSALKQLKIPNNGD 342

  Fly   302 YDY---------------------------IYDWTALQQQKDQICRSREQILESEREEVRKRDGE 339
            .|:                           ..|...|....|:...:.|...|.|.:..||:..:
  Fly   343 LDFKMKPQTSSNNNLSPPGTSKAATARKAKKIDSPVLNSSLDEKISASEDDEEEEEKSHRKKTAK 407

  Fly   340 R 340
            :
  Fly   408 K 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7094NP_609851.2 STKc_CK1 26..291 CDD:270918 80/293 (27%)
SPS1 26..>266 CDD:223589 73/268 (27%)
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 82/305 (27%)
SPS1 47..432 CDD:223589 92/374 (25%)
Pol_alpha_B_N <399..>502 CDD:285602 2/10 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452727
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11909
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.