DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7094 and CG8878

DIOPT Version :9

Sequence 1:NP_609851.2 Gene:CG7094 / 35065 FlyBaseID:FBgn0032650 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001260913.1 Gene:CG8878 / 36302 FlyBaseID:FBgn0027504 Length:1004 Species:Drosophila melanogaster


Alignment Length:255 Identity:61/255 - (23%)
Similarity:115/255 - (45%) Gaps:44/255 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 VHERGFIHRDIKPD--NFLMGLDRHCNKLYLIDFGLSKRYKDIESEIHIPYRTD--RNLTGTVRY 197
            :..||..|.|..|.  .||...:.|   ::||||||:.:::|  ..:|.|:..|  |...||:.:
  Fly   496 LRSRGSKHLDNNPTEYKFLPTEEEH---VFLIDFGLASKFQD--RGVHRPFIMDQRRAHDGTLEF 555

  Fly   198 ASINAQIGVEQSRRDDMESMSYCLMYFNLGKLPWQGITAANKKQKYEKILEKKT--SVTIAQLCK 260
            .|.:|.:|. .|||.|:|.:.|.|:|::.|.|||:.:.   ::|:.||:...|.  ...:.::.:
  Fly   556 TSRDAHLGA-HSRRSDLECLGYNLLYWSEGYLPWKDVA---QQQQQEKVHRAKELFMTDVPEMLR 616

  Fly   261 GF-----PSEFCLLMTYVRNLGFKEPPDHTYLRQIFRILFRSLNHHYDYIYDWTALQQQKDQI-- 318
            .|     |......:..:..|.::|.|::...|:||:..::.|.      ||...::...::|  
  Fly   617 QFYGKQVPKYLGEFLLQIGQLAYQERPNYERYRKIFKREYQRLG------YDPCQMRLSSEEILR 675

  Fly   319 -CRSREQILESEREEVRKRDGERGCEPQRDKERHKDLELDRLHKTSTQQAKCSNGHLTNR 377
             |.|.:.:::..:.::.:.:.:......|:               ||.........||||
  Fly   676 TCVSTKDVVDGSKCDIFELNNKAAVNVMRN---------------STLSTPFQEHSLTNR 720

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7094NP_609851.2 STKc_CK1 26..291 CDD:270918 46/164 (28%)
SPS1 26..>266 CDD:223589 42/139 (30%)
CG8878NP_001260913.1 PKc_like 112..>286 CDD:304357
SPS1 123..>284 CDD:223589
SPS1 <491..756 CDD:223589 61/255 (24%)
PKc_like <517..652 CDD:304357 39/143 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11909
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.