DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7094 and Vrk1

DIOPT Version :9

Sequence 1:NP_609851.2 Gene:CG7094 / 35065 FlyBaseID:FBgn0032650 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001012194.1 Gene:Vrk1 / 362779 RGDID:1306069 Length:414 Species:Rattus norvegicus


Alignment Length:345 Identity:99/345 - (28%)
Similarity:161/345 - (46%) Gaps:53/345 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KYRLVKPIGSGSFGDIYL---GLSITDGSEV--AIKVEKNDAKYPQLIYEAKVYEQLARCP---- 81
            :::|..|||.|.||.|||   ..|...||:.  .:|||.:|  ...|..|.|.|::.|: |    
  Rat    36 EWKLGLPIGQGGFGCIYLADTNSSKPVGSDAPCVVKVEPSD--NGPLFTELKFYQRAAK-PEQIQ 97

  Fly    82 -----------GFPTL----LHYGCEKNYNAMVMDLLGPSLEELFNLCKRRFSLKTVLMLTDQLL 131
                       |.|..    ||....|:|..|:||..|..|::::....:|||.||||.|:.::|
  Rat    98 KWIHTHKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLRIL 162

  Fly   132 MRIECVHERGFIHRDIKPDNFLMGLDRHCNKLYLIDFGLSKRYKDIESEIHIPYRTD--RNLTGT 194
            ..:|.:||..::|.|||..|.|:.. ::.:::||:|:||:.||  ....:|..|:.|  |...||
  Rat   163 DILEYIHEHEYVHGDIKASNLLLSY-KNPDQVYLVDYGLAYRY--CPDGVHKEYKEDPKRCHDGT 224

  Fly   195 VRYASINAQIGVEQSRRDDMESMSYCLMYFNLGKLPWQGITAANKKQKYEKILEKKTSVTIAQLC 259
            :.:.||:|..||..|||.|:|.:.||::.:..|.|||:.........:..||..:.....:.:.|
  Rat   225 LEFTSIDAHNGVAPSRRGDLEILGYCMIQWLSGCLPWEDNLKDPNYVRQSKIRYRDNVAALMEKC 289

  Fly   260 ---KGFPSEFCLLMTYVRNLGFKEPPDHTYLRQIFRILFRSLNHHYDYIYDWTALQ--------- 312
               :..|.|....|..|:.|.:.|.|.:..||.|.....:::....|...|::|::         
  Rat   290 FPERNKPGEIAKYMETVKLLDYTEKPLYQNLRDILLQGLKAIGSKDDGKLDFSAVENGSVNTKPA 354

  Fly   313 ---------QQKDQICRSRE 323
                     :::..:|...|
  Rat   355 SKKRKKGAVEEESSVCAVEE 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7094NP_609851.2 STKc_CK1 26..291 CDD:270918 93/293 (32%)
SPS1 26..>266 CDD:223589 85/268 (32%)
Vrk1NP_001012194.1 STKc_VRK1 26..326 CDD:271024 94/295 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.