DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7094 and Vrk2

DIOPT Version :9

Sequence 1:NP_609851.2 Gene:CG7094 / 35065 FlyBaseID:FBgn0032650 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_008768654.1 Gene:Vrk2 / 360991 RGDID:1311585 Length:503 Species:Rattus norvegicus


Alignment Length:303 Identity:97/303 - (32%)
Similarity:143/303 - (47%) Gaps:52/303 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GGKYRLVKPIGSGSFGDIYLGLSITDGSEVA---IKVEKNDAKYPQ---LIYEAKVYEQLAR--C 80
            |.::.|.|.||||.||.|||........:.|   ||||     |.:   |..|.|.|::.|:  |
  Rat    26 GNQWALGKMIGSGGFGLIYLAFPTNKPEKDARHVIKVE-----YQENGPLFSELKFYQRAAKREC 85

  Fly    81 ------------PGFPTLLHYGCE----KNYNAMVMDLLGPSLEELFNLCKRRFSLKTVLMLTDQ 129
                        .|.|....:|..    ::|..|||:.||..|::|.|. ...|...|||.|..:
  Rat    86 IQKWVKQRKLDYLGVPVFYGFGLTDFKGRSYRFMVMERLGIDLQKLLNQ-NGAFKKLTVLQLGIR 149

  Fly   130 LLMRIECVHERGFIHRDIKPDNFLMGLDRHCNKLYLIDFGLSKRYKDIESEIHIPYRTD--RNLT 192
            :|..:|.:||..::|.|||..|.|:|. .:.:::||.|:|||.||  ..:..|..|..|  :...
  Rat   150 MLDVLEYIHENEYVHGDIKAANLLLGY-ANPDRVYLADYGLSYRY--CPNGNHKQYHEDPRKGHN 211

  Fly   193 GTVRYASINAQIGVEQSRRDDMESMSYCLMYFNLGKLPWQ-------GITAANKK---QKYEKIL 247
            ||:.:.|::|..||..|||.|:|.:.||::.:..|||||:       .:..|..|   :..|.:|
  Rat   212 GTLEFTSLDAHKGVAPSRRSDVEILGYCMLRWLCGKLPWETNLENPVAVQTAKTKLLDELPESVL 276

  Fly   248 EKKTSVTIAQLCKGFPSEFCLLMTYVRNLGFKEPPDHTYLRQI 290
            :..||   ...|:    |......||.||.:...||:..|::|
  Rat   277 KWTTS---GSSCR----ELAEFFMYVHNLAYDAKPDYQKLKKI 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7094NP_609851.2 STKc_CK1 26..291 CDD:270918 96/301 (32%)
SPS1 26..>266 CDD:223589 87/275 (32%)
Vrk2XP_008768654.1 PKc_like 16..314 CDD:304357 97/303 (32%)
Pkinase 29..290 CDD:278497 88/276 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.