DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7094 and CG5790

DIOPT Version :9

Sequence 1:NP_609851.2 Gene:CG7094 / 35065 FlyBaseID:FBgn0032650 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001286037.1 Gene:CG5790 / 35095 FlyBaseID:FBgn0032677 Length:665 Species:Drosophila melanogaster


Alignment Length:428 Identity:92/428 - (21%)
Similarity:149/428 - (34%) Gaps:98/428 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 IGSGSFGDIYL-------GLSITDGSEVAIKVEKNDAKYPQLIYEAKVYEQLARCPGFPTLLHYG 90
            ||||:|..:.|       ||..|.....||| ..|...:|:.|  .:..|.:.|..|...::...
  Fly   151 IGSGTFSTVLLGTLQRERGLVETQRRRFAIK-HHNPTNHPERI--LRELECMYRIGGVENVIGIN 212

  Fly    91 CEKNYNAMVMDLLGPSLEELFNLCKRRFSLKTVLMLTDQLLMRIECVHERGFIHRDIKPDNFLMG 155
            |...||..|..::.....:.|:...|..:...:......||:.:..||:...||||:||.|.|  
  Fly   213 CCIRYNDNVAFIMPYMTHDRFHDIYRSLNFPEIRDYLRNLLIALRHVHKFNVIHRDVKPSNIL-- 275

  Fly   156 LDRHCNKLYLIDFGLSKRYKD-------------------------------------IESEIHI 183
            .:|...|..|.||||::|..|                                     .|:|.::
  Fly   276 YNRRTGKFLLCDFGLAQRIADDGSVVQSSDLSSREVFSILRDLENGRSVTLTDGNSAQAEAEDYM 340

  Fly   184 PYR----------TDRNLTGTVRYASINAQIGVEQSRRDDMESMSYCLMYFNLGKL------PWQ 232
            ..|          .:|.:||......:..|.|...:::|.....:..:...|..:|      |..
  Fly   341 ARRRMRALGGGGSVERAVTGPPSIQKLREQAGGHLTKKDVANQRADTMRLLNRLRLVSPNADPNN 405

  Fly   233 GITAAN--KKQKY------------EKILE-KKTSVTIAQLCKGFPSEFCLLMTYVRNLG--FKE 280
            .:.:.|  ||:.:            |.:|. .|.|..:.....|     .::::.:..|.  ||.
  Fly   406 YVVSTNTSKKEMHASRAGTPGYRPPEVLLRYPKQSTAVDVWAAG-----VIMLSLLSGLHPFFKA 465

  Fly   281 PPDHTYLRQIFRILFRSLNHHYDYIYDWTALQQQKDQICRSREQILESEREEVRKRDGERGCEPQ 345
            |.|...|.:|..:..........::.|...|..||       ...|:..|..:|.|..:....|:
  Fly   466 PHDCGALAEIINLFGDMPVRKTAFLLDRLILLAQK-------VNTLDLRRVCMRFRHADFFLAPE 523

  Fly   346 RDKERHK---DLELDRLHKTSTQQAKCSN-GHLTNRYD 379
            ..::..:   ..|:.|..:..|....||| ||...|||
  Fly   524 IQRKYQRPDGTTEMCRSCEQPTFNCLCSNSGHNLERYD 561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7094NP_609851.2 STKc_CK1 26..291 CDD:270918 71/334 (21%)
SPS1 26..>266 CDD:223589 65/307 (21%)
CG5790NP_001286037.1 STKc_Cdc7 143..597 CDD:270921 92/428 (21%)
S_TKc 145..597 CDD:214567 92/428 (21%)
PKc_like <238..>363 CDD:304357 28/126 (22%)
PKc_like <364..>462 CDD:304357 15/102 (15%)
PKc_like <427..597 CDD:304357 32/147 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452720
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11909
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.