DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7094 and CG2577

DIOPT Version :9

Sequence 1:NP_609851.2 Gene:CG7094 / 35065 FlyBaseID:FBgn0032650 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster


Alignment Length:325 Identity:165/325 - (50%)
Similarity:219/325 - (67%) Gaps:19/325 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GKYRLVKPIGSGSFGDIYLGLSITDGSEVAIKVEKNDAKYPQLIYEAKVYEQLARCPGFPTLLHY 89
            |.|::|:.||.|||||||||:.|..|..||||||.:..::|||.||.::|..|....|.|.:.::
  Fly    15 GNYKVVRKIGCGSFGDIYLGIYIHSGERVAIKVESSKVRHPQLNYERRIYRALRPAHGLPRIRYF 79

  Fly    90 GCEKNYNAMVMDLLGPSLEELFNLCKRRFSLKTVLMLTDQLLMRIECVHERGFIHRDIKPDNFLM 154
            ..|::|.||||||||||||.||..|:|.|::||||:|.:|:|.|:|.||.|||:|||||||||||
  Fly    80 HKEEHYQAMVMDLLGPSLERLFQFCERAFTIKTVLLLAEQMLRRVEYVHNRGFLHRDIKPDNFLM 144

  Fly   155 GLDRHCNKLYLIDFGLSKRYKDIESEIHIPYRTDRNLTGTVRYASINAQIGVEQSRRDDMESMSY 219
            ||.....::|||||||||:|.||.:.:|||||.:|:||||.|||||.|..|||.:|||||.::.|
  Fly   145 GLGTMSKQVYLIDFGLSKKYLDITTGVHIPYREERSLTGTARYASIGAHAGVESARRDDMVAVGY 209

  Fly   220 CLMYFNLGKLPWQGITAANKKQKYEKILEKKTSVTIAQLCKGFPSEFCLLMTYVRNLGFKEPPDH 284
            .|||||.|.||||.:.|:.|:||||:|.|||.||:|..||:|||.||.:.:.|.|.:||.:.|::
  Fly   210 VLMYFNRGSLPWQDLKASTKQQKYERIHEKKISVSIEVLCEGFPCEFTMYLNYCRGMGFYDKPNY 274

  Fly   285 TYLRQIFRILFRSLNHHYDYIYDWTALQ-------------------QQKDQICRSREQILESER 330
            .::.::||:|...||.....||||..|.                   :||:....|.|.|::.|:
  Fly   275 DFICRMFRMLRNGLNLRPGLIYDWDMLMMKFHNTQKNPGIGMRVFPPKQKEDDGISGEPIIKDEK 339

  Fly   331  330
              Fly   340  339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7094NP_609851.2 STKc_CK1 26..291 CDD:270918 148/264 (56%)
SPS1 26..>266 CDD:223589 141/239 (59%)
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 148/264 (56%)
SPS1 16..>242 CDD:223589 133/225 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469565
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 1 1.000 - - FOG0000297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11909
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.