DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7094 and cki3

DIOPT Version :9

Sequence 1:NP_609851.2 Gene:CG7094 / 35065 FlyBaseID:FBgn0032650 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_593916.1 Gene:cki3 / 2542395 PomBaseID:SPAC1805.05 Length:439 Species:Schizosaccharomyces pombe


Alignment Length:309 Identity:148/309 - (47%)
Similarity:206/309 - (66%) Gaps:3/309 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LIGGKYRLVKPIGSGSFGDIYLGLSITDGSEVAIKVEKNDAKYPQLIYEAKVYEQLARCPGFPTL 86
            ::|..||:.|.||.||||.::.|:::.:...:|:|.|...::.|||..|...|:.|...||.|::
pombe    10 VVGVHYRVGKKIGEGSFGMLFQGVNLINNQPIALKFESRKSEVPQLRDEYLTYKLLMGLPGIPSV 74

  Fly    87 LHYGCEKNYNAMVMDLLGPSLEELFNLCKRRFSLKTVLMLTDQLLMRIECVHERGFIHRDIKPDN 151
            .:||.|..||.:||||||||||:||:.|.||||.|||.|:..|::.||:.||||.||:|||||||
pombe    75 YYYGQEGMYNLLVMDLLGPSLEDLFDYCGRRFSPKTVAMIAKQMITRIQSVHERHFIYRDIKPDN 139

  Fly   152 FLMGL--DRHCNKLYLIDFGLSKRYKDIESEIHIPYRTDRNLTGTVRYASINAQIGVEQSRRDDM 214
            ||:|.  .:..|.:|.:|||::|:|:|.::.:|.||...::|:||.||.|||..:|.|||||||:
pombe   140 FLIGFPGSKTENVIYAVDFGMAKQYRDPKTHVHRPYNEHKSLSGTARYMSINTHLGREQSRRDDL 204

  Fly   215 ESMSYCLMYFNLGKLPWQGITAANKKQKYEKILEKKTSVTIAQLCKGFPSEFCLLMTYVRNLGFK 279
            |||.:..|||..|.|||||:.||..|||||||.|||....:.:||:|:|.||...|.|.||||::
pombe   205 ESMGHVFMYFLRGSLPWQGLKAATNKQKYEKIGEKKQVTPLKELCEGYPKEFLQYMIYARNLGYE 269

  Fly   280 EPPDHTYLRQIFRILFRSLNHHYDYIYDWTALQQQKD-QICRSREQILE 327
            |.||:.|||.:|..|...:|...|..||||.|...|. |...:::.:::
pombe   270 EAPDYDYLRSLFDSLLLRINETDDGKYDWTLLNNGKGWQYSAAKQHVVQ 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7094NP_609851.2 STKc_CK1 26..291 CDD:270918 136/266 (51%)
SPS1 26..>266 CDD:223589 122/241 (51%)
cki3NP_593916.1 SPS1 14..353 CDD:223589 147/305 (48%)
PKc_like 14..290 CDD:304357 138/275 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 64 1.000 Domainoid score I2867
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.