DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7094 and hhp2

DIOPT Version :9

Sequence 1:NP_609851.2 Gene:CG7094 / 35065 FlyBaseID:FBgn0032650 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_593184.1 Gene:hhp2 / 2541929 PomBaseID:SPAC23C4.12 Length:400 Species:Schizosaccharomyces pombe


Alignment Length:293 Identity:161/293 - (54%)
Similarity:210/293 - (71%) Gaps:2/293 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 IGGKYRLVKPIGSGSFGDIYLGLSITDGSEVAIKVEKNDAKYPQLIYEAKVYEQLARCPGFPTLL 87
            ||.|||:.:.|||||||.|||||:..:|.:||:|:|...|::.||.||.:||..|....|.||:.
pombe     8 IGNKYRIGRKIGSGSFGQIYLGLNTVNGEQVAVKLEPLKARHHQLEYEFRVYNILKGNIGIPTIR 72

  Fly    88 HYGCEKNYNAMVMDLLGPSLEELFNLCKRRFSLKTVLMLTDQLLMRIECVHERGFIHRDIKPDNF 152
            .:|...:||||||||||||||:||..|.|:|:|||||:|.|||:.|||.||.:.|:|||||||||
pombe    73 WFGVTNSYNAMVMDLLGPSLEDLFCYCGRKFTLKTVLLLADQLISRIEYVHSKSFLHRDIKPDNF 137

  Fly   153 LMGLDRHCNKLYLIDFGLSKRYKDIESEIHIPYRTDRNLTGTVRYASINAQIGVEQSRRDDMESM 217
            ||  .:|.|.:.:|||||:|:|:|.::.:|||||.::|||||.||||||..||:|||||||:||:
pombe   138 LM--KKHSNVVTMIDFGLAKKYRDFKTHVHIPYRDNKNLTGTARYASINTHIGIEQSRRDDLESL 200

  Fly   218 SYCLMYFNLGKLPWQGITAANKKQKYEKILEKKTSVTIAQLCKGFPSEFCLLMTYVRNLGFKEPP 282
            .|.|:||..|.|||||:.|..|:|||::|.:.|....:..||||.|.||...|.|.|.|.|.|.|
pombe   201 GYVLLYFCRGSLPWQGLQADTKEQKYQRIRDTKIGTPLEVLCKGLPEEFITYMCYTRQLSFTEKP 265

  Fly   283 DHTYLRQIFRILFRSLNHHYDYIYDWTALQQQK 315
            ::.|||::||.|.....:.|||::||..|:.||
pombe   266 NYAYLRKLFRDLLIRKGYQYDYVFDWMILKYQK 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7094NP_609851.2 STKc_CK1 26..291 CDD:270918 148/264 (56%)
SPS1 26..>266 CDD:223589 136/239 (57%)
hhp2NP_593184.1 SPS1 11..353 CDD:223589 159/290 (55%)
PKc_like 11..283 CDD:304357 151/273 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoFinder 1 1.000 - - FOG0000297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.