DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7094 and ZK507.1

DIOPT Version :9

Sequence 1:NP_609851.2 Gene:CG7094 / 35065 FlyBaseID:FBgn0032650 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_499015.2 Gene:ZK507.1 / 191336 WormBaseID:WBGene00013978 Length:331 Species:Caenorhabditis elegans


Alignment Length:270 Identity:85/270 - (31%)
Similarity:129/270 - (47%) Gaps:40/270 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GLSITDGSEVAIKVE-KNDAKY-PQLIYEAKVYEQLARCPG-----FPTLLHYGCEKNYNAMVMD 101
            |.:| |..|.|:|.| |..:|: .:|..|..|.|..::|..     |..|:.:|....:..:||.
 Worm     7 GFAI-DDKEYAMKTELKFASKHSSRLKIERNVMESYSKCDAQCKEHFSELIDFGQSPVWKWIVMT 70

  Fly   102 LLGPSLEELFNLCKRRFS-----LKTVLMLTDQLLMRIECVHERGFIHRDIKPDNFLMGLDRHCN 161
            ::|||||||    |.::.     ..|:|....|.:..|...|:.||:||||||.|:.:|......
 Worm    71 IVGPSLEEL----KMKYKPSDIPPSTILQCGLQTMKAIHDFHQIGFLHRDIKPANYCIGYGSKSE 131

  Fly   162 KLYLIDFGLSKRYKDIESEIHIPYRTDRNLTGTVRYASINAQIGVEQSRRDDMESMSYCLMYFNL 226
            .:|::||||:::|:....::. |.|....:.||.||.|..:....|..||||.|  |:..|:.:|
 Worm   132 TIYVLDFGLARKYRLPNGQVR-PPRPKTKMIGTPRYCSRASHRCEELGRRDDYE--SWFFMFIDL 193

  Fly   227 ---GKLPWQGIT---AANKKQK-------YEK-ILEKKTSVTIAQLCKGFPSEFCLL----MTYV 273
               ..:.|:|:|   |..|||:       ||| .:.|..|:.:..|......:|.:|    ..|.
 Worm   194 VDTTLIDWKGLTRPDAYAKKQELFTKLKTYEKHPMFKVISIYLDNLVYDSEVKFGVLREAITDYA 258

  Fly   274 R--NLGFKEP 281
            |  .|..|||
 Worm   259 RGCKLTLKEP 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7094NP_609851.2 STKc_CK1 26..291 CDD:270918 85/270 (31%)
SPS1 26..>266 CDD:223589 77/247 (31%)
ZK507.1NP_499015.2 SPS1 9..>168 CDD:223589 53/164 (32%)
PKc_like 10..252 CDD:304357 78/249 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.