DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7094 and T15B12.2

DIOPT Version :9

Sequence 1:NP_609851.2 Gene:CG7094 / 35065 FlyBaseID:FBgn0032650 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001367879.1 Gene:T15B12.2 / 188528 WormBaseID:WBGene00020531 Length:446 Species:Caenorhabditis elegans


Alignment Length:395 Identity:111/395 - (28%)
Similarity:182/395 - (46%) Gaps:73/395 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 IGSGSFGDIYLGLSITD----GSEVAIKVEKNDAKYPQLIYEAKVYEQL-------ARCPGFPTL 86
            ||||.|||:|   .:.|    ..|.|:|.|.:.|:..:|..|..:.:::       .:...|..|
 Worm    57 IGSGGFGDVY---RVYDEPNPKMEYAMKTEVHGAQQRRLSIEKSILKEIDTYTTTHKKSRHFCEL 118

  Fly    87 LHYGCEKNYNAMVMDLLGPSLEELFNLCKRRFSLKTVLMLTDQLLMRIECVHERGFIHRDIKPDN 151
            :..|..|:|:.:||.|:|||||.:..:.||:::...|:.:..|:|..:|.:||.||||||:||.|
 Worm   119 IDSGQTKDYSWIVMTLIGPSLESVRRMLKRQYTKSCVINMALQILDAVEVMHEVGFIHRDLKPAN 183

  Fly   152 FLMGL---DRHCNKLYLIDFGLSKR-YKDIESEIH--------IPYRTDRNLTGTVRYASINAQI 204
            ...|.   |.|.  ||::|||:|:| :|  .|:.|        :|:      .||.:::|.....
 Worm   184 ICTGTPPQDDHV--LYVLDFGISRRVFK--SSKCHELRNKRERVPF------FGTRKFSSRACHQ 238

  Fly   205 GVEQSRRDDMESMSYCL--MYFNLGKLPWQGITAANKKQKYEKILEKKTSV---TIAQLCKGFPS 264
            ..:|.|:||||:..|.:  ::.|...|.|....|     ...||:|||.::   ...:|.|..||
 Worm   239 EKDQGRKDDMETYLYTILDLFHNERGLSWSKDLA-----DVNKIIEKKHALFENPTKELDKIIPS 298

  Fly   265 EFCLLMTYVRNLGFKEPPDHTYLRQIFRILFRSL--NHHYDYIYDWTALQQQKDQICRSREQILE 327
            ....::.|:|.|.|::|.|:..:....|...:.:  :...|...|||.          ..||:|:
 Worm   299 GIDNIIVYLRGLKFEDPVDYRQIENELRTAGKKMAPSDSSDETMDWTG----------KLEQLLK 353

  Fly   328 --SEREEVRKRDGERGCEPQRDK-ERHKDLELD-----RLHKTSTQQAKCSNGHLTNRYDRIGDG 384
              ::.:.|....||.....:|.| :|.:|:..|     .:..|..:....|.|       ...|.
 Worm   354 EANKNKAVGTPKGEETLLYERLKAKRDRDMTTDAVKTVEMRATINRDVDASEG-------MFNDK 411

  Fly   385 GISKR 389
            |::.|
 Worm   412 GLTTR 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7094NP_609851.2 STKc_CK1 26..291 CDD:270918 89/285 (31%)
SPS1 26..>266 CDD:223589 83/260 (32%)
T15B12.2NP_001367879.1 STKc_TTBK 51..353 CDD:270919 96/323 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.