DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7094 and K08H2.5

DIOPT Version :9

Sequence 1:NP_609851.2 Gene:CG7094 / 35065 FlyBaseID:FBgn0032650 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001361832.1 Gene:K08H2.5 / 187176 WormBaseID:WBGene00010692 Length:304 Species:Caenorhabditis elegans


Alignment Length:218 Identity:53/218 - (24%)
Similarity:101/218 - (46%) Gaps:29/218 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 YRLVKPIGSGSFGDIYLGLSITDG----SEVAIKVEKNDAKYPQLIY--EAKVYEQLARC----- 80
            |::|:.:|||.:|..:   :..|.    |.:|:|....:..:.:..:  |..|.::::..     
 Worm    13 YKIVEVLGSGEYGTAF---ACVDADSRHSTLALKASNLETIFCENCFKLERTVLQRISTLGTNEK 74

  Fly    81 PGFPTLL-HYGCEKNYNAMVMDLLGPSLEELFNLCKR----RFSLKTVLMLTDQLLMRIECVHER 140
            ..||||: ::..:.....:||...|.||.:   :|||    :||...||.:...:...::.:|..
 Worm    75 SRFPTLVDNFVVDSTLGCLVMTKEGDSLGD---VCKRNDPKKFSPTNVLKIMLSVGKSLQTIHSL 136

  Fly   141 GFIHRDIKPDNFLMGLD-RHCNKLYLIDFGLSKRYKDIESEIHIPYRTDRNLT-GTVRYASINAQ 203
            |:|||||..:|.|.... ...:...|||:|:.|::::.... ::..|..|::. ....:.|.|..
 Worm   137 GYIHRDIHWNNVLFAKTITPASPCKLIDYGVGKKFRNRRGN-YVKNRPQRDVNFKECGHVSWNVM 200

  Fly   204 IGVEQSRRDDMESMSYCLMYFNL 226
            :|...:.:||..|    ||:..|
 Worm   201 MGGVPNLKDDFSS----LMFLGL 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7094NP_609851.2 STKc_CK1 26..291 CDD:270918 53/218 (24%)
SPS1 26..>266 CDD:223589 53/218 (24%)
K08H2.5NP_001361832.1 PKc_like 12..>185 CDD:389743 43/178 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.