DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7094 and K06H7.8

DIOPT Version :9

Sequence 1:NP_609851.2 Gene:CG7094 / 35065 FlyBaseID:FBgn0032650 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_498768.1 Gene:K06H7.8 / 187079 WormBaseID:WBGene00019459 Length:346 Species:Caenorhabditis elegans


Alignment Length:308 Identity:83/308 - (26%)
Similarity:144/308 - (46%) Gaps:43/308 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LIGGKYRLVKPIGSGSFGDIYLGLSITDGSE----VAIKVE-KNDAKYPQLIYEAKVYEQL---- 77
            ::|.:|::|:.:|.|..|.::   .:.|.||    .|:||| |:......|..|.::..||    
 Worm    15 VVGKRYKVVQKLGEGGCGSVF---KVEDTSEKGQHYALKVEFKSQDAGNILKMEVQILSQLISKK 76

  Fly    78 --ARCPGFPTLLHYGCEKNYNAMVMDLLGPSLEELFNLCKRRFSLKTVLMLTDQLLMRIECVHER 140
              |:|      :..|.::.|:.|||.|||.||:.|........::.|.:.:...:|..|:.||:.
 Worm    77 HVAKC------VASGKKERYSYMVMTLLGESLDSLLKKHGPFLNVSTQVRIGICILFGIKQVHDI 135

  Fly   141 GFIHRDIKPDNFLMGLDRHCNKLY--LIDFGLSKRYKDIESEIHIPYRTDRNLT---GTVRYASI 200
            |::|||:||.|..||.....::.|  ::||||:::|...|.: .:..|..|..|   ||.||.|:
 Worm   136 GYLHRDLKPANVAMGCKGSADERYFLVLDFGLARQYIADEDD-GLKMRRPREKTYFRGTARYCSV 199

  Fly   201 NAQIGVEQSRRDDMESMSYCLMYFNLGKLPWQGI-----TAANKKQKYEKILEKKTSVTIAQLCK 260
            ......||.|.||:.::.|.|..... :|.|..:     ....|::.::::|..|:.|.:....|
 Worm   200 AMHDRYEQGRVDDLWALVYILAEMRC-RLAWHDVDDKVEIGEMKRKIHDEVLFAKSPVQMLSFVK 263

  Fly   261 GFPSEFCLLMTYVRNLGFKEPPDHTYLRQIFRILFRSLNHHYDYIYDW 308
                       .||:..|...||:..|.::...:.:..|:.:...|.|
 Worm   264 -----------TVRSTLFYHRPDYEKLFKLLEDVMKCANYKWSDPYHW 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7094NP_609851.2 STKc_CK1 26..291 CDD:270918 79/285 (28%)
SPS1 26..>266 CDD:223589 73/260 (28%)
K06H7.8NP_498768.1 STKc_TTBK 19..284 CDD:270919 79/286 (28%)
S_TKc 20..263 CDD:214567 72/253 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.