DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7094 and F59E12.3

DIOPT Version :9

Sequence 1:NP_609851.2 Gene:CG7094 / 35065 FlyBaseID:FBgn0032650 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_495099.2 Gene:F59E12.3 / 186628 WormBaseID:WBGene00019119 Length:141 Species:Caenorhabditis elegans


Alignment Length:132 Identity:34/132 - (25%)
Similarity:52/132 - (39%) Gaps:28/132 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LIGG--------KYRLVKPIGSGSFGDIYLGLSITDGSEVAIKVE-----KNDAKYPQLIYEAKV 73
            |.||        .|.:.:.|..||||.|:.....:.|:.:.:|.|     .||.:. :|:...:|
 Worm     9 LAGGTELTTSISTYTINEKIAEGSFGAIFKVTEKSTGTRLVLKAELPGSPSNDLRI-ELVTMLRV 72

  Fly    74 YEQLARCPGFPTLLHYGCEKNYNAMVMDLLGPSLEELF-----NLCKRRFSLKTVLMLTDQLLMR 133
            :....     |.:...|.......::|.|.|.|||::.     |.|    ||.|.:....|.|..
 Worm    73 FRSYV-----PEVTDKGVFNGTKFLIMPLFGKSLEDIIGALPGNKC----SLSTAIGSLYQCLEA 128

  Fly   134 IE 135
            ||
 Worm   129 IE 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7094NP_609851.2 STKc_CK1 26..291 CDD:270918 31/120 (26%)
SPS1 26..>266 CDD:223589 31/120 (26%)
F59E12.3NP_495099.2 PKc_like 21..>130 CDD:304357 29/118 (25%)
SPS1 22..>130 CDD:223589 29/117 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.