DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7094 and F53C3.1

DIOPT Version :9

Sequence 1:NP_609851.2 Gene:CG7094 / 35065 FlyBaseID:FBgn0032650 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_494695.2 Gene:F53C3.1 / 186157 WormBaseID:WBGene00018745 Length:328 Species:Caenorhabditis elegans


Alignment Length:296 Identity:87/296 - (29%)
Similarity:149/296 - (50%) Gaps:24/296 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 YRLVKPIGSGSFGDIYLGLSITDGSEVAIKVEK--NDAKYPQLIYEAKVYEQLARCPGFPTLLHY 89
            |.:|:.:|.|.||.:||........:.|:||||  :..|:.:|..|..:.:.:..|..|..:...
 Worm    24 YTVVRLLGEGGFGAVYLVEQAKTKKQFAMKVEKKMDTRKHSKLKMEIAILKLVGTCKHFTKIEDR 88

  Fly    90 G--CEKNYNAMVMDLLGPSLEELFNLCKRR----FSLKTVLMLTDQLLMRIECVHERGFIHRDIK 148
            |  .::.|..:||.|:|.||.   .|.|.|    |:..|.:.:..|.|..:|.:|::||||||:|
 Worm    89 GKKDKEGYFFIVMQLVGKSLS---GLKKERPNQIFTFGTGMGVGSQCLEAVEELHKQGFIHRDLK 150

  Fly   149 PDNFLMGLDRHCNKLYLIDFGLSKRYKDIESEIHIPYRTDRNLTGTVRYASINAQIGVEQSRRDD 213
            |.|:..|.|...:.:|::|||::::|.:.:.|:..| |......||:|:|.::.....|...:||
 Worm   151 PQNYASGQDDERHLIYILDFGIARKYLNDKKEMKTP-RESVAFKGTIRFAPLSCHRYTEMGPKDD 214

  Fly   214 MESMSYCLMYFNL-GKLPWQGITAANKKQKYEKILEKKTSVTIAQLCKGFP--SEFCLLMTYVRN 275
            .||..|.|:...| |.|||:.....|:..|.::...|...   |.|.||.|  ||...::.|:.:
 Worm   215 CESWFYLLIDLILEGGLPWRHCKVKNEVLKIKENTRKDNR---AALYKGIPQTSELNKILDYIDS 276

  Fly   276 LGFKEPPDHTYLRQIFRILFRSLNH---HYDYIYDW 308
            ..:::..|:.:   |::.|..:.::   ..:..|||
 Worm   277 RAYQDRIDYKF---IYKALGEACSNAGCDINAPYDW 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7094NP_609851.2 STKc_CK1 26..291 CDD:270918 82/274 (30%)
SPS1 26..>266 CDD:223589 79/249 (32%)
F53C3.1NP_494695.2 PKc_like 23..292 CDD:389743 83/277 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.