DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7094 and F26A1.4

DIOPT Version :9

Sequence 1:NP_609851.2 Gene:CG7094 / 35065 FlyBaseID:FBgn0032650 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_497995.2 Gene:F26A1.4 / 184945 WormBaseID:WBGene00017803 Length:206 Species:Caenorhabditis elegans


Alignment Length:166 Identity:51/166 - (30%)
Similarity:80/166 - (48%) Gaps:23/166 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 QLLMRIECVHERGFIHRDIKPDNFLMGLDRHCNKLYLIDFGLSKRYKDIESEIHIPYRTDRNLTG 193
            |:|..:..||...|:||||||.|..:|. ..|.::||||:.|:::|.|....:..| |....|.|
 Worm     3 QVLKALALVHRAEFLHRDIKPPNCCIGA-TDCTRIYLIDYVLTRQYLDKCGTVRNP-RPGLGLRG 65

  Fly   194 TVRYASINAQIGVEQSRRDDMESMSYCLMYFNLGKLPWQGITAANKKQKYEKILEKKTSVTIAQL 258
            |:||.|::|....:...::|:.|..|..:....|.|||          .|||  .::..:.:.|.
 Worm    66 TMRYMSLDAHARQDLGPKNDLVSFLYTTIECGDGCLPW----------SYEK--SEENCIKLKQA 118

  Fly   259 CKGFPSEFCL---LMT----YVRNLGFKEPPDHTYL 287
            ..|  .:.|:   |||    |:.:|.:...||:..|
 Worm   119 HIG--EKLCIKKPLMTKAAEYIESLNYHSIPDYEKL 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7094NP_609851.2 STKc_CK1 26..291 CDD:270918 51/166 (31%)
SPS1 26..>266 CDD:223589 42/136 (31%)
F26A1.4NP_497995.2 PKc_like <3..157 CDD:389743 51/166 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.