DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7094 and F22F1.2

DIOPT Version :9

Sequence 1:NP_609851.2 Gene:CG7094 / 35065 FlyBaseID:FBgn0032650 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_509374.1 Gene:F22F1.2 / 184850 WormBaseID:WBGene00017714 Length:299 Species:Caenorhabditis elegans


Alignment Length:309 Identity:80/309 - (25%)
Similarity:119/309 - (38%) Gaps:78/309 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 YRLVKPIGSGSFGDIYLGLSITDGSEVAIKV---EKNDAKYPQLIYEAKVYEQLARCPGFPTLLH 88
            |.|.|.:|.||:||:|......:.....||:   |.|..:......|......||...|...:..
 Worm    11 YILEKKLGEGSYGDVYFCRDERNNKWSVIKLIHKEINGVRDETWRRETFALTALAEVRGISRMYD 75

  Fly    89 YGCEKNYNAMVMDLLGPSLEELFNLCKRR----FSLKTVLMLTDQLLMRIECVHERGFIHRDIKP 149
            ||....:|.:||:   |.|::|.|:.:|.    ||..|...:..||:..::.||..|..|.|||.
 Worm    76 YGATDIHNYIVME---PLLDDLTNIARRNGIKGFSKSTGFHILWQLVKILQDVHSFGIAHGDIKA 137

  Fly   150 DNFLMGLDRHCNKLYLIDFGLSKRYKDIESE--------------IHIPYRTDRNLTGTVRYASI 200
            ||.::........|.|:|||||:.:||....              ||.|.||..           
 Worm   138 DNLMISGSNKTFMLSLVDFGLSRSFKDHNGNRTPPIPFPSGCINLIHTPARTAN----------- 191

  Fly   201 NAQIGVEQSRRDDMESMSY--CLMYFNLGKL-PWQGITAANKKQKYEKILEKKTSVTIAQLCKGF 262
                |......:|:..::|  |:    ..|| ||:.|. .:|..|.:|...:|            
 Worm   192 ----GKPHMEAEDLMQVAYLACI----CRKLAPWEDID-GHKMTKLKKAFAEK------------ 235

  Fly   263 PSEFCLLMTYVRNLGFKEPPDHTYLRQIFRILFRSLNH----HYDYIYD 307
            |.:|         ||     :|..|:.|.:|:.:. .|    :|..|.|
 Worm   236 PKKF---------LG-----EHQDLKPIIKIIAKQ-KHGKEPNYKEIMD 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7094NP_609851.2 STKc_CK1 26..291 CDD:270918 74/287 (26%)
SPS1 26..>266 CDD:223589 69/262 (26%)
F22F1.2NP_509374.1 PKc_like 15..272 CDD:389743 78/305 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.