DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7094 and C14A4.13

DIOPT Version :9

Sequence 1:NP_609851.2 Gene:CG7094 / 35065 FlyBaseID:FBgn0032650 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_496292.1 Gene:C14A4.13 / 182582 WormBaseID:WBGene00007563 Length:471 Species:Caenorhabditis elegans


Alignment Length:401 Identity:110/401 - (27%)
Similarity:170/401 - (42%) Gaps:84/401 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKQEATNGKVRNASLHLEKLLIGGKYRLVKPIGSGSFGDIYLGLSITDGSEVAIKVEKNDAKYP 65
            ||...|...|.:.....| ..:|.|::..|:.||.|::|.:|         ||   |.:|.   |
 Worm     1 MAAVVAVKQKEKGPQCKL-STIINGQFMAVQMIGKGAYGVVY---------EV---VRRNS---P 49

  Fly    66 QLIYEAKV-----YEQLARCPGFPTLL------------HYGCEKNYNAMVMDLLGPSLEEL-FN 112
            ...:..|.     :..|.......|||            ..|.|:|:|.:||.|:||||.:| ..
 Worm    50 NTRFACKAELAIDHNNLKTEWDLMTLLKDNKSKHNIIGVELGSERNFNYIVMHLVGPSLSDLRKT 114

  Fly   113 LCKRRFSLKTVLMLTDQLLMRIECVHERGFIHRDIKPDNFLMG-LDRHCNKL-YLIDFGLSKRYK 175
            :..:.|:|.|..:...|....:..:...|:||||:||.||.:| |.....|| |::||||.:...
 Worm   115 VPNKTFTLFTTAVCAIQCFDSLVEIQRIGYIHRDVKPSNFAIGVLGSEEEKLVYVLDFGLCRNMF 179

  Fly   176 DIESEIHIPYRTDRNLTGTVRYASINAQIGVEQSRRDDMESMSYCLMYFNLGKLPWQGITAANKK 240
            :.:.|:..| |......||:.|.|:|....:|..|.||..|:.|.::.|:|..|||:.::    |
 Worm   180 NKQKELRKP-RMKAPFRGTILYCSLNIHQRMEPGRHDDFWSLLYMMIEFHLSDLPWENMS----K 239

  Fly   241 QKYEKILEKKTSVTIAQLCKGFPSEFCLLMTYVRNLGFKEPPDHTYLRQIFRILFRSLNHHYDYI 305
            :..:|..|.|....:|: |   |.||.::..|:..|.:.:.||:..||::...:..|.....|..
 Worm   240 EDTKKAKETKLDGLLAR-C---PPEFRMIRCYLLTLTYSKEPDYVKLREVLCQIMTSKKFTPDMP 300

  Fly   306 YDWTALQQQKDQICRSREQILESEREEVR-------------------------KRD----GERG 341
            .||     ||...|   |.|.:.:...|:                         :||    ||: 
 Worm   301 LDW-----QKGGPC---EAIFKPQAAVVKHKGTKKKVSLAELLDLPKPGGKVYTERDFPQPGEQ- 356

  Fly   342 CEPQRDKERHK 352
             ||.||:...|
 Worm   357 -EPMRDESVSK 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7094NP_609851.2 STKc_CK1 26..291 CDD:270918 84/284 (30%)
SPS1 26..>266 CDD:223589 76/259 (29%)
C14A4.13NP_496292.1 PKc_like 29..286 CDD:389743 84/280 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.