DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7094 and B0218.5

DIOPT Version :9

Sequence 1:NP_609851.2 Gene:CG7094 / 35065 FlyBaseID:FBgn0032650 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_501367.1 Gene:B0218.5 / 181853 WormBaseID:WBGene00015049 Length:367 Species:Caenorhabditis elegans


Alignment Length:361 Identity:102/361 - (28%)
Similarity:165/361 - (45%) Gaps:66/361 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KYRLVKPIGSGSFGDIYLGLSITDGSEVAIKVEKNDAKYPQLIYEAKVYEQLARCPG--FPTLLH 88
            :|:::..:|.|.:|.:|..|.::|..:.|||.|...|....|..:..|.:..|:...  |.|::.
 Worm    23 RYKVLALLGKGGYGAVYSVLRLSDMEKFAIKCENAAACRKALYMDCNVLKGAAKIQSRHFCTVID 87

  Fly    89 YGCEKN-YNAMVMDLLGPSLEEL-FNLCKRRFSLKTVLMLTDQLLMRIECVHERGFIHRDIKPDN 151
            ....|| :|.:||.|:|.:|.:| .:..:.||:..|.|....|.|:.||.:|..||:||||||.|
 Worm    88 QAAVKNRFNFIVMKLIGKNLWDLRMDTAECRFTKGTSLKAASQCLISIEELHRFGFLHRDIKPGN 152

  Fly   152 FLMG---LDRHCNKLYLIDFGLSKRY-KDIESEIHIPYRTDR---NLTGTVRYASINAQIGVEQS 209
            |.:|   .:.| :.::::||||.:.: |..|..:    ||.|   ...||.|||.||:.:.::..
 Worm   153 FAVGRKESNEH-HTIFMLDFGLCREFVKRGEGRL----RTQRAKSQFRGTTRYAPINSMLEIDTG 212

  Fly   210 RRDDMESMSYCLMYFNLGKLPWQGITAANKKQKYEKILEKKTSV-----TIAQLCKGFP-SEFCL 268
            |:||:||..|.:..:..|.|||:...|..:    ||:|:.|..|     .:|.|....| .||..
 Worm   213 RKDDIESWLYMVAEWTSGGLPWRKFKATER----EKVLKYKKDVRTDKEIMADLFYNCPLKEFER 273

  Fly   269 LMTYVRNLGFKEPPDHTYLRQIFRILFRSLNH-----------------------HYDYIYDWTA 310
            ::.||..|.|...||       ::.::..|.|                       ..:.|.|...
 Worm   274 ILKYVDELDFYSEPD-------YKFVYCCLQHAAAASKIKDTDPLDWDPNVPYMGPIETIGDGKV 331

  Fly   311 LQQQKDQ----------ICRSREQILESEREEVRKR 336
            ::...||          ..|.||....::|.|::|:
 Worm   332 IELDVDQGMSTEVSFNKTGRDRETADATKRVEIKKK 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7094NP_609851.2 STKc_CK1 26..291 CDD:270918 90/281 (32%)
SPS1 26..>266 CDD:223589 82/256 (32%)
B0218.5NP_501367.1 PKc_like 23..297 CDD:389743 90/289 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.