DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7094 and C09B9.4

DIOPT Version :9

Sequence 1:NP_609851.2 Gene:CG7094 / 35065 FlyBaseID:FBgn0032650 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_500708.1 Gene:C09B9.4 / 177271 WormBaseID:WBGene00015629 Length:359 Species:Caenorhabditis elegans


Alignment Length:341 Identity:94/341 - (27%)
Similarity:154/341 - (45%) Gaps:60/341 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RNASLHLEKLLIGGK-------YRLVKPIGSGSFGDIYLGLSITDGSEVAIKVE-KNDAKYPQLI 68
            ||::..|...|:|.:       |::...|.:|.|..::  |...||...|:||| ::....|.|.
 Worm     7 RNSTNDLLMPLLGKRIRLGDHVYKMCDSIATGPFSSVF--LVEKDGIPYAMKVESQSKCLRPVLK 69

  Fly    69 YEAKVYEQLARCPGFPTLLHYGCEKNYNAMVMDLLGPSLEELFNLC-KRRFSLKTVLMLTDQLLM 132
            .:..|...|....|||:|...|..:|:..:||.|:||.|..|.... ::||:..||..:..|.|.
 Worm    70 LDHAVLRALGHQSGFPSLTSAGRTENFKYVVMQLVGPDLSMLLEFAPQQRFTSSTVYKIALQTLD 134

  Fly   133 RIECVHERGFIHRDIKPDNFLMGLDRHCNKLYLIDFGLSKRYKDIESEIHIPYRTDRNL------ 191
            |:..:||.|:::||:|..||.:||....:.:|::||||:::|        :.:...|:|      
 Worm   135 RLRVLHEAGWLNRDVKAQNFAVGLGEESSIVYMLDFGLTRKY--------LEHNGSRSLLRPHGP 191

  Fly   192 -TGTVRYASINAQIG-VEQSRRDDMESMSYCLMYFNLGKLPWQGITAANKKQ--KYEKILEKKTS 252
             .||..||.: |.:| .:||..||:|...|.:::...|.|||.     |.|:  ...|:.|.|  
 Worm   192 SVGTFPYAPL-ASLGFCDQSPIDDIEGWLYMIVHLLKGGLPWH-----NSKRALNLPKVREWK-- 248

  Fly   253 VTIAQLCK----------GFPSEFCLLMTYVRNLGFKEPPDHTYLRQIFRILFRSLNHHYDYI-- 305
                ..|:          |.|..:..:...:.|....|.||:..:..:  :|..:.|...|..  
 Worm   249 ----MYCRRPGGKHYLFAGIPKGWADIFDVIVNTAPHETPDYNKIANM--VLSIARNELIDLTAP 307

  Fly   306 YDWTALQQQKDQICRS 321
            :||     |.:.:.||
 Worm   308 FDW-----QVNPVLRS 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7094NP_609851.2 STKc_CK1 26..291 CDD:270918 81/293 (28%)
SPS1 26..>266 CDD:223589 77/268 (29%)
C09B9.4NP_500708.1 PKc_like 29..289 CDD:389743 81/281 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.