DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7094 and Y39G8C.2

DIOPT Version :9

Sequence 1:NP_609851.2 Gene:CG7094 / 35065 FlyBaseID:FBgn0032650 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_496946.1 Gene:Y39G8C.2 / 175061 WormBaseID:WBGene00012731 Length:276 Species:Caenorhabditis elegans


Alignment Length:254 Identity:79/254 - (31%)
Similarity:127/254 - (50%) Gaps:23/254 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EATNGKVRNASLHLEKLLIGGKYRLVKPIGSGSFGDIYLGLSITDGSEVAIKVEK--NDAKYPQL 67
            |.::||              ..|.:.:.:|.|.||.:||..........|:|||:  ...|:.:|
 Worm    16 EISSGK--------------ANYVVSRLLGEGGFGAVYLVKDTKTNKTFAMKVEQKMEKRKHSKL 66

  Fly    68 IYEAKVYEQLARCPGFPTLLHYG--CEKNYNAMVMDLLGPSLEELFN-LCKRRFSLKTVLMLTDQ 129
            ..|..:.:.:.....|..::..|  .::.|..:||:|:|.||.:|.| ..:|.||..|.|.:..|
 Worm    67 KMEIAILKLVGAGKHFTQIVDRGKKDKEGYFFLVMELVGKSLGDLKNERAERVFSFGTGLGVASQ 131

  Fly   130 LLMRIECVHERGFIHRDIKPDNFLMGLDRHCNKLYLIDFGLSKRYKDIESEIHIPYRTDRNLTGT 194
            .|..:|.:|..||||||:||.|:..|||...:.:|::|||::::|.:.::|:..| |......||
 Worm   132 CLEAVEDLHRTGFIHRDLKPQNYACGLDEKRHNIYILDFGIARKYLNTKNELKTP-REAVGFKGT 195

  Fly   195 VRYASINAQIGVEQSRRDDMESMSYCLMYFNLGK-LPWQGITAANK--KQKYEKILEKK 250
            ||:|.:......|...|||.||..|.|:...|.: |||:.:....:  |:|.|...||:
 Worm   196 VRFAPLACHRFTELGPRDDCESWFYLLLDLILPRGLPWRKMNEKGEVLKEKEECRKEKR 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7094NP_609851.2 STKc_CK1 26..291 CDD:270918 76/233 (33%)
SPS1 26..>266 CDD:223589 76/233 (33%)
Y39G8C.2NP_496946.1 PKc_like 23..276 CDD:389743 76/233 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S180
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.