DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7094 and F59A6.4

DIOPT Version :9

Sequence 1:NP_609851.2 Gene:CG7094 / 35065 FlyBaseID:FBgn0032650 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_494922.2 Gene:F59A6.4 / 173865 WormBaseID:WBGene00019086 Length:762 Species:Caenorhabditis elegans


Alignment Length:339 Identity:91/339 - (26%)
Similarity:159/339 - (46%) Gaps:49/339 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 YRLVKPIGSGSFGDIYL----GLSITDGSEVAIKVEKNDAKYPQLIYEAKVYEQLA------RCP 81
            ::::..:|||.|||:|.    ...||....:..:.|:.:.:|.:|..|..|..:.|      :..
 Worm   444 WKVINLLGSGGFGDVYKVHRESQPITKCYALKTESEEGEKRYLRLKIEVTVMMKTAEKKKENKFK 508

  Fly    82 GFPTLLHYG-CEK-NYNAMVMDLLGPSLEELFNLCKRR-----FSLKTVLMLTDQLLMRIECVHE 139
            .|...:..| ||: ....:||.|:|||||::    :|:     ||..|...:..|.:..::.:|.
 Worm   509 NFIEFVDRGKCEQLKCKYVVMGLVGPSLEDI----RRKYLLGSFSKHTSFNVAIQTVTALQDLHS 569

  Fly   140 RGFIHRDIKPDNFLMGLDRHCNKLYLIDFGLSKRYKDIESEIHIPYRTDRNLTGTVRYASINAQI 204
            .|::||||||.|:.:||:...:.:|::|||::|.|.|...| |...|......||:|||.....:
 Worm   570 IGYLHRDIKPANYAVGLEDREDTVYMLDFGIAKLYVDENGE-HKVKRKKVKFLGTLRYACRACMM 633

  Fly   205 GVEQSRRDDMESMSYCLMYFNL----GKLPWQGITA-----ANKKQKYEKILEKKTSVTIAQLCK 260
            ..||.|:||:|:..|  :.|:|    ..:||:.:.:     .:|.:.:........|.|:.:| |
 Worm   634 QQEQGRKDDLETWIY--LVFDLMDESHGMPWRSLCSPKEILKSKNEFFTNFDSSSVSATLKRL-K 695

  Fly   261 GFPSEFCLLMTYVRNLGFKEPPDHTYLRQIFRILFRSLNHHYDYIYDWTALQQQKDQICRSREQI 325
            |       |::||.|:.::..||:.|:....:..............||...       .:::|..
 Worm   696 G-------LVSYVDNMQYETTPDYDYIINFLKTTATEAGAKISKKLDWIGK-------LKNKEFD 746

  Fly   326 LESEREEVRKRDGE 339
            .||:|.: :|..||
 Worm   747 SESDRSD-KKASGE 759

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7094NP_609851.2 STKc_CK1 26..291 CDD:270918 82/289 (28%)
SPS1 26..>266 CDD:223589 75/264 (28%)
F59A6.4NP_494922.2 PKc_like 120..372 CDD:304357
SPS1 121..>274 CDD:223589
SPS1 443..>627 CDD:223589 56/187 (30%)
PKc_like 444..720 CDD:304357 82/290 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.