DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7094 and H05L14.1

DIOPT Version :9

Sequence 1:NP_609851.2 Gene:CG7094 / 35065 FlyBaseID:FBgn0032650 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_492198.1 Gene:H05L14.1 / 172575 WormBaseID:WBGene00010366 Length:794 Species:Caenorhabditis elegans


Alignment Length:307 Identity:83/307 - (27%)
Similarity:146/307 - (47%) Gaps:45/307 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVRNASLHLEKLLIGGKY--RLVKPIGSGSFGDIYLGLSITDG-------SEVAIKVEKNDAKYP 65
            |:.|.    :.::..|:|  ::|:.:|||.|||:|   .:.|.       :..|:|.|....|..
 Worm   446 KIMNP----DDVITNGQYAWKVVRLLGSGGFGDVY---KVFDDKAKGPKKTHYALKTESEGGKKA 503

  Fly    66 QLIYEAKVYEQLA------RCPG-----FPTLLHYGCEKNYNA--MVMDLLGPSLEELFNLCKRR 117
            .|..:.::...:.      :..|     |...:..|..:....  :||.|:||||::    |:|:
 Worm   504 MLRLKVEMQVMITISDARKKSKGDVNRHFVDFIDRGKSEELKCKYIVMSLVGPSLDD----CRRK 564

  Fly   118 FSL-----KTVLMLTDQLLMRIECVHERGFIHRDIKPDNFLMGLDRHCNKLYLIDFGLSKRYKDI 177
            |.:     .|..::..|.|..|..:|..|::||||||.||.:|:....:.::::|||:.:.|.|.
 Worm   565 FGVNLSNTSTPYIIAIQTLESIRDLHNLGYLHRDIKPANFAVGVGAKESTVFMLDFGIGRSYLDP 629

  Fly   178 ESEIHIPYRTDRNLTGTVRYASINAQIGVEQSRRDDMESMSYCLMYFNLGKLPWQGITAANKKQK 242
            :::.|...|......||:||||....:.|:|.|:||:|...|  |.|::.. |..|::.  |||:
 Worm   630 KTKQHRAPRKKVKFLGTLRYASRACMLEVDQGRKDDLECWIY--MVFDIFD-PKNGVSW--KKQR 689

  Fly   243 YE-KILEKKTSVTIAQLCKGF-PSEFCLLMTYVRNLGFKEPPDHTYL 287
            .. ||.|.|......:....: |.....::.|:.:|.|:..|::..|
 Worm   690 DRVKIREAKQLFFDGKAQYDYAPISLRPIIIYINSLQFQTTPEYANL 736

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7094NP_609851.2 STKc_CK1 26..291 CDD:270918 80/291 (27%)
SPS1 26..>266 CDD:223589 75/268 (28%)
H05L14.1NP_492198.1 PKc_like 137..385 CDD:304357
SPS1 194..>369 CDD:223589
PKc_like 461..736 CDD:304357 78/286 (27%)
SPS1 461..>651 CDD:223589 53/196 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.