DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7094 and CSNK1A1L

DIOPT Version :9

Sequence 1:NP_609851.2 Gene:CG7094 / 35065 FlyBaseID:FBgn0032650 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_660204.2 Gene:CSNK1A1L / 122011 HGNCID:20289 Length:337 Species:Homo sapiens


Alignment Length:334 Identity:191/334 - (57%)
Similarity:249/334 - (74%) Gaps:7/334 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KLLIGGKYRLVKPIGSGSFGDIYLGLSITDGSEVAIKVEKNDAKYPQLIYEAKVYEQLARCPGFP 84
            :|::||||:||:.||||||||:|||::.|:|.:||:|:|....|:|||:||:|:|..|....|.|
Human    10 ELVVGGKYKLVRKIGSGSFGDVYLGITTTNGEDVAVKLESQKVKHPQLLYESKLYTILQGGVGIP 74

  Fly    85 TLLHYGCEKNYNAMVMDLLGPSLEELFNLCKRRFSLKTVLMLTDQLLMRIECVHERGFIHRDIKP 149
            .:..||.||:.|.:||||||||||:|||.|.|||::||||||.||::.|||.||.:.|:||||||
Human    75 HMHWYGQEKDNNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFLHRDIKP 139

  Fly   150 DNFLMGLDRHCNKLYLIDFGLSKRYKDIESEIHIPYRTDRNLTGTVRYASINAQIGVEQSRRDDM 214
            ||||||..||||||:||||||:|:|:|..:..|||||.|::|.||||||||||.:|:||||||||
Human   140 DNFLMGTGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKHLIGTVRYASINAHLGIEQSRRDDM 204

  Fly   215 ESMSYCLMYFNLGKLPWQGITAANKKQKYEKILEKKTSVTIAQLCKGFPSEFCLLMTYVRNLGFK 279
            ||:.|..||||...|||||:.|..||||||||.|||.|..:..||||||:||.:.:.|.|.|.|:
Human   205 ESLGYVFMYFNRTSLPWQGLRAMTKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFE 269

  Fly   280 EPPDHTYLRQIFRILFRSLNHHYDYIYDWTALQQQKDQICRSREQILESEREEVRKRDGERGCEP 344
            |.||:.||||:||||||:|||.|||.:|||.|:|:..|...|.    ..:.::.:.:.|:   :.
Human   270 EVPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQAASS----SGQGQQAQTQTGK---QT 327

  Fly   345 QRDKERHKD 353
            :::|...||
Human   328 EKNKNNVKD 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7094NP_609851.2 STKc_CK1 26..291 CDD:270918 165/264 (63%)
SPS1 26..>266 CDD:223589 152/239 (64%)
CSNK1A1LNP_660204.2 STKc_CK1_alpha 16..281 CDD:271030 165/264 (63%)
SPS1 16..>239 CDD:223589 142/222 (64%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 309..337 5/35 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S180
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 1 1.000 - - FOG0000297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100396
Panther 1 1.100 - - O PTHR11909
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.740

Return to query results.
Submit another query.