DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7094 and Csnk1a1

DIOPT Version :9

Sequence 1:NP_609851.2 Gene:CG7094 / 35065 FlyBaseID:FBgn0032650 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_038952461.1 Gene:Csnk1a1 / 113927 RGDID:71098 Length:374 Species:Rattus norvegicus


Alignment Length:368 Identity:199/368 - (54%)
Similarity:257/368 - (69%) Gaps:32/368 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KLLIGGKYRLVKPIGSGSFGDIYLGLSITDGSEVAIKVEKNDAKYPQLIYEAKVYEQLARCPGFP 84
            :.::||||:||:.|||||||||||.::||:|.|||:|:|...|::|||:||:|:|:.|....|.|
  Rat    10 EFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIP 74

  Fly    85 TLLHYGCEKNYNAMVMDLLGPSLEELFNLCKRRFSLKTVLMLTDQLLMRIECVHERGFIHRDIKP 149
            .:..||.||:||.:||||||||||:|||.|.|||::||||||.||::.|||.||.:.||||||||
  Rat    75 HIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKP 139

  Fly   150 DNFLMGLDRHCNK----------------------------LYLIDFGLSKRYKDIESEIHIPYR 186
            ||||||:.|||||                            |:||||||:|:|:|..:..|||||
  Rat   140 DNFLMGIGRHCNKCLESPVGKRKRSMTVSPSQDPSFSGLNQLFLIDFGLAKKYRDNRTRQHIPYR 204

  Fly   187 TDRNLTGTVRYASINAQIGVEQSRRDDMESMSYCLMYFNLGKLPWQGITAANKKQKYEKILEKKT 251
            .|:|||||.|||||||.:|:||||||||||:.|.|||||...|||||:.||.||||||||.|||.
  Rat   205 EDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKM 269

  Fly   252 SVTIAQLCKGFPSEFCLLMTYVRNLGFKEPPDHTYLRQIFRILFRSLNHHYDYIYDWTALQQQKD 316
            |..:..||||||:||.:.:.|.|.|.|:|.||:.||||:||||||:|||.|||.:|||.|:|:..
  Rat   270 STPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAA 334

  Fly   317 QICRSREQILESEREEVRKRDGERGCEPQRDKERHKDLELDRL 359
            |...|.    ..:.::.:...|::..:.:.:.:..||.:||.|
  Rat   335 QQAASS----SGQGQQAQTPTGKQTDKTKSNMKGIKDEKLDPL 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7094NP_609851.2 STKc_CK1 26..291 CDD:270918 172/292 (59%)
SPS1 26..>266 CDD:223589 159/267 (60%)
Csnk1a1XP_038952461.1 STKc_CK1_alpha 16..309 CDD:271030 172/292 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353375
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 1 1.000 - - FOG0000297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100396
Panther 1 1.100 - - O PTHR11909
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.