DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7094 and Csnk1d

DIOPT Version :9

Sequence 1:NP_609851.2 Gene:CG7094 / 35065 FlyBaseID:FBgn0032650 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_011246964.1 Gene:Csnk1d / 104318 MGIID:1355272 Length:428 Species:Mus musculus


Alignment Length:393 Identity:190/393 - (48%)
Similarity:249/393 - (63%) Gaps:36/393 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KLLIGGKYRLVKPIGSGSFGDIYLGLSITDGSEVAIKVEKNDAKYPQLIYEAKVYEQLARCPGFP 84
            :|.:|.:|||.:.||||||||||||..|..|.|||||:|....|:|||..|:|:|:.:....|.|
Mouse     2 ELRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQGGVGIP 66

  Fly    85 TLLHYGCEKNYNAMVMDLLGPSLEELFNLCKRRFSLKTVLMLTDQLLMRIECVHERGFIHRDIKP 149
            |:...|.|.:||.|||:|||||||:|||.|.|:|||||||:|.||::.|||.:|.:.|||||:||
Mouse    67 TIRWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKP 131

  Fly   150 DNFLMGLDRHCNKLYLIDFGLSKRYKDIESEIHIPYRTDRNLTGTVRYASINAQIGVEQSRRDDM 214
            |||||||.:..|.:|:|||||:|:|:|..:..|||||.::|||||.||||||..:|:|||||||:
Mouse   132 DNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDL 196

  Fly   215 ESMSYCLMYFNLGKLPWQGITAANKKQKYEKILEKKTSVTIAQLCKGFPSEFCLLMTYVRNLGFK 279
            ||:.|.|||||||.|||||:.||.|:||||:|.|||.|..|..||||:||||...:.:.|:|.|.
Mouse   197 ESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFD 261

  Fly   280 EPPDHTYLRQIFRILFRSLNHHYDYIYDWTALQ-------QQKDQICRSREQILESEREEVRK-- 335
            :.||::||||:||.||......|||::||..|:       ...::..|.||:.|...|....:  
Mouse   262 DKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGASRAADDAERERRDREERLRHSRNPATRGL 326

  Fly   336 ---RDGE-RGCE--------------------PQRDKERHKDLELDRLHKTSTQQAKCSNGHLTN 376
               ..|. ||.:                    |....||.:.:.: |||:.:  ....|:..||.
Mouse   327 PSTASGRLRGTQEVAPPTPLTPTSHTANTSPRPVSGMERERKVSM-RLHRGA--PVNVSSSDLTG 388

  Fly   377 RYD 379
            |.|
Mouse   389 RQD 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7094NP_609851.2 STKc_CK1 26..291 CDD:270918 159/264 (60%)
SPS1 26..>266 CDD:223589 148/239 (62%)
Csnk1dXP_011246964.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 163/273 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100396
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.