DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7094 and Vrk3

DIOPT Version :9

Sequence 1:NP_609851.2 Gene:CG7094 / 35065 FlyBaseID:FBgn0032650 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_598706.1 Gene:Vrk3 / 101568 MGIID:2182465 Length:453 Species:Mus musculus


Alignment Length:274 Identity:65/274 - (23%)
Similarity:121/274 - (44%) Gaps:50/274 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 KNDAKYPQLIYEAKVYEQLAR------------CP--GFPTLLHYGCEKN-YNAMVMDLLGPSLE 108
            |.|:|..:|..|...::::|:            .|  ..||.:.:|..:: |..:|...||.||:
Mouse   182 KLDSKDGRLFNEQNFFQRVAKPLQVNKWKKQFLLPLLAIPTCIGFGIHQDKYRFLVFPSLGRSLQ 246

  Fly   109 E-LFNLCKRRFSLKTVLMLTDQLLMRIECVHERGFIHRDIKPDNFLMGLDRHCNKLYLIDFGLSK 172
            . |.:..|...|.:.||.:..:||..:|.:||..::|.::..:|..:. ....:::.|:.:|.:.
Mouse   247 SALDDNPKHVVSERCVLQVACRLLDALEYLHENEYVHGNLTAENVFVN-PEDLSQVTLVGYGFTY 310

  Fly   173 RYKDIESEIHIPYRTDRNL--TGTVRYASINAQIGVEQSRRDDMESMSYCLMYFNLGKLPW---- 231
            ||  .....|:.|:.....  .|.:.:.|::...|...|||.|::::.||::.:..|.|||    
Mouse   311 RY--CPGGKHVAYKEGSRSPHDGDLEFISMDLHKGCGPSRRSDLQTLGYCMLKWLYGSLPWTNCL 373

  Fly   232 ---QGITAANKKQKY----EKILE-----KKTSVTIAQLCKGFPSEFCLLMTYVRNLGFKEPPDH 284
               :.||  .:||||    |:::.     .|.|.|:.:..|           .|..|.::|.|.:
Mouse   374 PNTEKIT--RQKQKYLDSPERLVGLCGRWNKASETLREYLK-----------VVMALNYEEKPPY 425

  Fly   285 TYLRQIFRILFRSL 298
            ..||.....|.:.:
Mouse   426 ATLRNSLEALLQDM 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7094NP_609851.2 STKc_CK1 26..291 CDD:270918 64/265 (24%)
SPS1 26..>266 CDD:223589 58/240 (24%)
Vrk3NP_598706.1 zinc_ribbon_2 4..26 CDD:379084
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..123
Nuclear localization signal. /evidence=ECO:0000269|PubMed:14645249 49..64
PKc_like 134..436 CDD:389743 64/269 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.