DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7094 and ttbk1a

DIOPT Version :9

Sequence 1:NP_609851.2 Gene:CG7094 / 35065 FlyBaseID:FBgn0032650 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_009304405.1 Gene:ttbk1a / 100332125 ZFINID:ZDB-GENE-100609-4 Length:1298 Species:Danio rerio


Alignment Length:330 Identity:111/330 - (33%)
Similarity:164/330 - (49%) Gaps:39/330 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 NGKVRNASLHLEKLLIGGKYRLVKPIGSGSFGDIYLGLSITDGSEVAIKVEKNDAKYPQLIYEAK 72
            ||......:.....::..:::::|.||.|.||:||..|.:.....||:|||  .|:.|:.:.:.:
Zfish    31 NGTAEQQDILPPHCMVKDRWKVLKKIGGGGFGEIYEALDLLTRENVALKVE--SAQQPKQVLKME 93

  Fly    73 VYEQLARCPGFPTLLHY-GCEKN--YNAMVMDLLGPSLEELFNLCKRR------FSLKTVLMLTD 128
            | ..|.:..|...:..: ||.:|  :|.:||.|.|.:|.:|     ||      |::.|.|.|..
Zfish    94 V-AVLKKLQGKNHVCKFIGCGRNDKFNYVVMQLQGRNLADL-----RRSQPRGTFTMSTTLRLGK 152

  Fly   129 QLLMRIECVHERGFIHRDIKPDNFLMG-LDRHCNKLYLIDFGLSKRYKDIESEIHIPYRTDRNLT 192
            |:|..||.:|..||:||||||.||.|| |.....|.|::||||:::|.:...|:. |.||.....
Zfish   153 QILESIEAIHSVGFLHRDIKPSNFAMGRLPSTFRKCYMLDFGLARQYTNTNGEVR-PPRTVAGFR 216

  Fly   193 GTVRYASINAQIGVEQSRRDDMESMSYCLMYFNLGKLPWQGITAANKKQKYEKILEKKTSVTIAQ 257
            |||||||:||....|..|.||:.|:.|.|:.|..|:|||:.|     |.| |::.:.|.......
Zfish   217 GTVRYASVNAHKNKEMGRHDDLWSLFYMLVEFAAGQLPWRKI-----KDK-EQVGQIKERYDHRM 275

  Fly   258 LCKGFPSEFCLLMTYVRNLGFKEPPDHTYLRQIFRILFRSLNHHYDYIYDW-------------- 308
            |.|..||||.:.:.:|..|.:...||:..|..:|....:......:..|||              
Zfish   276 LLKHMPSEFNVFLEHVLALDYYTKPDYQLLMSVFENSMKERIITENEPYDWEKSGTETIISATTP 340

  Fly   309 TALQQ 313
            ||.||
Zfish   341 TAAQQ 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7094NP_609851.2 STKc_CK1 26..291 CDD:270918 101/274 (37%)
SPS1 26..>266 CDD:223589 94/249 (38%)
ttbk1aXP_009304405.1 PKc_like 49..310 CDD:304357 101/275 (37%)
Pkinase 50..295 CDD:278497 97/259 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.