DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7094 and csnk1e

DIOPT Version :9

Sequence 1:NP_609851.2 Gene:CG7094 / 35065 FlyBaseID:FBgn0032650 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_997912.1 Gene:csnk1e / 100006858 ZFINID:ZDB-GENE-030131-7873 Length:417 Species:Danio rerio


Alignment Length:319 Identity:180/319 - (56%)
Similarity:230/319 - (72%) Gaps:0/319 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KLLIGGKYRLVKPIGSGSFGDIYLGLSITDGSEVAIKVEKNDAKYPQLIYEAKVYEQLARCPGFP 84
            :|.:|.||||.:.||||||||||||.:||.|.|||||:|....|:|||..|:|.|:.:....|.|
Zfish     2 ELRVGSKYRLGRKIGSGSFGDIYLGANITSGEEVAIKLESVKTKHPQLHIESKFYKMMQGGVGIP 66

  Fly    85 TLLHYGCEKNYNAMVMDLLGPSLEELFNLCKRRFSLKTVLMLTDQLLMRIECVHERGFIHRDIKP 149
            ::...|.|.:||.|||:|||||||:|||.|.|:|:|||||:|.||::.|||.:|.:.||||||||
Zfish    67 SIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFTLKTVLLLADQMISRIEYIHSKNFIHRDIKP 131

  Fly   150 DNFLMGLDRHCNKLYLIDFGLSKRYKDIESEIHIPYRTDRNLTGTVRYASINAQIGVEQSRRDDM 214
            |||||||.:..|.:|:|||||:|:|:|..:..|||||.::|||||.||||||..:|:|||||||:
Zfish   132 DNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDL 196

  Fly   215 ESMSYCLMYFNLGKLPWQGITAANKKQKYEKILEKKTSVTIAQLCKGFPSEFCLLMTYVRNLGFK 279
            ||:.|.|||||||.|||||:.||.|:||||:|.|||.|..|..|||||||||...|.:.|:|.|.
Zfish   197 ESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGFPSEFSTYMNFCRSLRFD 261

  Fly   280 EPPDHTYLRQIFRILFRSLNHHYDYIYDWTALQQQKDQICRSREQILESEREEVRKRDG 338
            :.||::||||:||.||......|||::||..|:....:....:|:....|.||..:|.|
Zfish   262 DKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGSSRTAEEKEKEQRGEGEERDERTG 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7094NP_609851.2 STKc_CK1 26..291 CDD:270918 162/264 (61%)
SPS1 26..>266 CDD:223589 150/239 (63%)
csnk1eNP_997912.1 SPS1 8..360 CDD:223589 178/313 (57%)
STKc_CK1_delta_epsilon 8..282 CDD:271027 166/273 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 1 1.000 - - FOG0000297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100396
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.730

Return to query results.
Submit another query.