DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mEFTs and Tsfm

DIOPT Version :9

Sequence 1:NP_609847.1 Gene:mEFTs / 35060 FlyBaseID:FBgn0032646 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_079813.1 Gene:Tsfm / 66399 MGIID:1913649 Length:324 Species:Mus musculus


Alignment Length:308 Identity:122/308 - (39%)
Similarity:163/308 - (52%) Gaps:35/308 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 YAG-SGGSGGLEKSALAALRKKTGYTFANCKKALEKHNNDVGLAEKWLHEQAQTLGWSKATKVAD 81
            :|| |..|....|..|..||:||||:|.|||||||....|:..||.|||:|||..|||||.|:..
Mouse    34 HAGPSLSSAASSKELLMKLRRKTGYSFVNCKKALETCGGDLKQAEDWLHKQAQKEGWSKAAKLHG 98

  Fly    82 RATAHGLIGVLIRGNRGAMVELNCETDFVARNDTFKRFVDHVA----CMCLQYTDLTDFDGDLWK 142
            |.|..||||:|..||...:||:|||||||:||..|::.|..||    ..|...||..    ..:.
Mouse    99 RKTKEGLIGLLQEGNTAVLVEVNCETDFVSRNLKFQQLVQQVALGTMAHCQNLTDRL----STYS 159

  Fly   143 LGF-DADALRNLRTEEGR--TLGDHLALLIGAIGENATIRRALCFKANNDLKLVGYAHPAPTNVG 204
            .|| ::..|..|.....|  :|.|.|||.||.:|||..::||...|..:...:..|.|       
Mouse   160 KGFLNSSELSELAAGPDREGSLKDQLALAIGKLGENMILKRAAWVKVPSGFYVGSYVH------- 217

  Fly   205 TTEGITQ--------VGKYGAIVAYRSTHPLLDF-EFHKSICQQIVGMKPTKIGEYDKDKPAENK 260
               |:||        :|||||:|...:...:.:. |..:.:.|.:|||.|..:|..| |:|  ..
Mouse   218 ---GVTQSPSLQNLVLGKYGALVICETPEQIANLEEVGRRLGQHVVGMAPLSVGSLD-DEP--GG 276

  Fly   261 DDETCLIHQEYLLDADKTVGEALQEHNCEIVDYHRFECGEHTERSLEA 308
            :.||.::.|.||||...|:|:.:|.....:||:.|||||| .|:..||
Mouse   277 ETETRMLPQPYLLDPSITLGQYVQPQGVTVVDFVRFECGE-DEQVAEA 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mEFTsNP_609847.1 UBA_EF-Ts 32..66 CDD:270461 20/33 (61%)
Tsf 35..303 CDD:223342 113/283 (40%)
EF_TS 98..300 CDD:279261 73/217 (34%)
TsfmNP_079813.1 tsf 42..316 CDD:236491 113/290 (39%)
UBA_EF-Ts 47..83 CDD:270461 20/35 (57%)
EF_TS 115..316 CDD:279261 73/217 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847419
Domainoid 1 1.000 83 1.000 Domainoid score I8358
eggNOG 1 0.900 - - E1_COG0264
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4184
Inparanoid 1 1.050 182 1.000 Inparanoid score I3960
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54697
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003815
OrthoInspector 1 1.000 - - oto94103
orthoMCL 1 0.900 - - OOG6_101036
Panther 1 1.100 - - LDO PTHR11741
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R369
SonicParanoid 1 1.000 - - X2659
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.