DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mEFTs and tsfm

DIOPT Version :9

Sequence 1:NP_609847.1 Gene:mEFTs / 35060 FlyBaseID:FBgn0032646 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_001073504.1 Gene:tsfm / 567785 ZFINID:ZDB-GENE-061215-17 Length:305 Species:Danio rerio


Alignment Length:284 Identity:108/284 - (38%)
Similarity:156/284 - (54%) Gaps:22/284 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 EKSALAALRKKTGYTFANCKKALEKHNNDVGLAEKWLHEQAQTLGWSKATKVADRATAHGLIGVL 92
            :|:.|..|||.|||||.||||||||.|||:..||.||||||:..|||||||:..|....||||::
Zfish    36 DKALLLQLRKSTGYTFVNCKKALEKCNNDITQAESWLHEQAKKEGWSKATKLEGRKAKEGLIGLM 100

  Fly    93 IRGNRGAMVELNCETDFVARNDTFKRFVDHVACMCLQYTDLTDFDGDLWKLGF-----DADALRN 152
            :..|...|||:||||||||||:.|::.|..||...:.:...:.      |.||     .::.:..
Zfish   101 MHDNAAVMVEVNCETDFVARNEKFQQLVKDVALSVMAHQSTSK------KTGFIKSVLSSEDMSK 159

  Fly   153 LRTEEGRTLGDHLALLIGAIGENATIRRALCFKANNDLKLVGYAHPAPTNVGTTEGIT--QVGKY 215
            |...:|.:|.|.|||.||.:|||..:|||:.....:|..:..|.|      ||..|..  ::|:|
Zfish   160 LNAPDGPSLADQLALTIGRLGENIAMRRAVSLSVPSDWHIGSYIH------GTVAGQVGIEMGRY 218

  Fly   216 GAIVAYRSTHPLLDFEFHKSICQQIVGMKPTKIGEYDKDKPAENKDDETCLIHQEYLLDADKTVG 280
            |::|.::.......:...:.:.|.::|..|..:|..|   .....|.||.|:.|.:|.|...||.
Zfish   219 GSLVVFQGEPKEGTYALGRKLAQHVMGEAPVSLGNMD---DLSCGDSETRLLPQTFLPDPKYTVA 280

  Fly   281 EALQEHNCEIVDYHRFECGEHTER 304
            :.|...:..::|:.||:|||.:.:
Zfish   281 QYLTLQDARVLDFIRFQCGESSSQ 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mEFTsNP_609847.1 UBA_EF-Ts 32..66 CDD:270461 24/33 (73%)
Tsf 35..303 CDD:223342 106/274 (39%)
EF_TS 98..300 CDD:279261 64/208 (31%)
tsfmNP_001073504.1 tsf 38..300 CDD:236491 105/276 (38%)
UBA_EF-Ts 38..74 CDD:270461 24/35 (69%)
EF_TS 106..300 CDD:279261 64/208 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592681
Domainoid 1 1.000 91 1.000 Domainoid score I7732
eggNOG 1 0.900 - - E1_COG0264
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4184
Inparanoid 1 1.050 194 1.000 Inparanoid score I3827
OMA 1 1.010 - - QHG54697
OrthoDB 1 1.010 - - D1048278at2759
OrthoFinder 1 1.000 - - FOG0003815
OrthoInspector 1 1.000 - - oto41708
orthoMCL 1 0.900 - - OOG6_101036
Panther 1 1.100 - - LDO PTHR11741
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R369
SonicParanoid 1 1.000 - - X2659
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.