DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15142 and CDK2AP1

DIOPT Version :9

Sequence 1:NP_609846.1 Gene:CG15142 / 35059 FlyBaseID:FBgn0032645 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_004633.1 Gene:CDK2AP1 / 8099 HGNCID:14002 Length:115 Species:Homo sapiens


Alignment Length:159 Identity:37/159 - (23%)
Similarity:65/159 - (40%) Gaps:61/159 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 IKTHVPQVEITRVSGAASAGSSSTANAAMMLRNRQQTNSAALAYANEYKEVMA-----KLEYTKY 100
            :..|:|...:   :.|.|..|.||                ::|.:::|:::::     .|.||: 
Human     7 LAAHMPAAAL---NAAGSVHSPST----------------SMATSSQYRQLLSDYGPPSLGYTQ- 51

  Fly   101 MQAQLQIMSAANGGGGGFGIDSDLFGTSIGLDENANI-VDKYSDLLNVLGEMRTNVPTTMAGLRA 164
                                     ||.     |:.: ..||::||.::.|:...:..|.||.::
Human    52 -------------------------GTG-----NSQVPQSKYAELLAIIEELGKEIRPTYAGSKS 86

  Fly   165 PKERMQRDIAHARLKVRQCLQLLQQAEEE 193
            ..||::|.|.|||..||:||     ||.|
Human    87 AMERLKRGIIHARGLVRECL-----AETE 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15142NP_609846.1 CDK2AP 1..192 CDD:286844 35/156 (22%)
CDK2AP1NP_004633.1 Interaction with CDK2AP2. /evidence=ECO:0000269|PubMed:14985111 20..25 1/4 (25%)
CDK2AP <62..114 CDD:370710 22/54 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4713
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22607
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.