Protein Alignment CG15142 and Cdk2ap2

DIOPT Version :9

• Sequence 1: NP_609846.1
• Gene: CG15142 / 35059
• FlyBaseID: FBgn0032645
• Length: 206
• Species: Drosophila melanogaster
• Sequence 2: NP_080649.1
• Gene: Cdk2ap2 / 52004
• MGIID: 1098779
• Length: 127
• Species: Mus musculus
• Alignment Length: 53
• Identity: 24/53 - (45%)
• Similarity: 33/53 - (62%)
• Gaps: 5/53 - (9%)

  Fly   141 YSDLLNVLGEMRTNVPTTMAGLRAPKERMQRDIAHARLKVRQCLQLLQQAEEE 193
            |:|||:|:.||...:..|.||.::..||::|.|.|||..||:||     ||.|
Mouse    75 YTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECL-----AETE 122

Known Domains

Gene	Sequence	Domain	Region	External ID	Identity
CG15142	NP_609846.1	CDK2AP	1..192	CDD:286844	22/50 (44%)
Cdk2ap2	NP_080649.1	Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite	1..47
		rad23	<5..>107	CDD:273167	13/31 (42%)
		CDK2AP	<63..126	CDD:370710	24/53 (45%)
		Interaction with CDK2. /evidence=ECO:0000250|UniProtKB:O75956	65..107		13/31 (42%)

Information from Original Tools

Tool	Simple Score	Weighted Score	Original Tool Information
			BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4713
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR22607
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	1	0.960	-	-
	4	3.870