powered by:
Protein Alignment CG15142 and cdk2ap2
DIOPT Version :9
Sequence 1: | NP_609846.1 |
Gene: | CG15142 / 35059 |
FlyBaseID: | FBgn0032645 |
Length: | 206 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001009898.1 |
Gene: | cdk2ap2 / 494160 |
ZFINID: | ZDB-GENE-040718-35 |
Length: | 111 |
Species: | Danio rerio |
Alignment Length: | 74 |
Identity: | 28/74 - (37%) |
Similarity: | 40/74 - (54%) |
Gaps: | 7/74 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 122 SDLFGTSIGLDENANIV--DKYSDLLNVLGEMRTNVPTTMAGLRAPKERMQRDIAHARLKVRQCL 184
||....|:|..:...:. ..||:||:|:.||...:..|.||.::..||::|.|.|||..||:||
Zfish 38 SDFGPPSMGFVQPVKVSQGSTYSELLSVIEEMSREIRPTYAGSKSAMERLKRGIIHARALVRECL 102
Fly 185 QLLQQAEEE 193
||.|
Zfish 103 -----AETE 106
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG15142 | NP_609846.1 |
CDK2AP |
1..192 |
CDD:286844 |
26/71 (37%) |
cdk2ap2 | NP_001009898.1 |
CDK2AP |
<58..110 |
CDD:313096 |
24/54 (44%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR22607 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.