DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15142 and cdk2ap2

DIOPT Version :9

Sequence 1:NP_609846.1 Gene:CG15142 / 35059 FlyBaseID:FBgn0032645 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001009898.1 Gene:cdk2ap2 / 494160 ZFINID:ZDB-GENE-040718-35 Length:111 Species:Danio rerio


Alignment Length:74 Identity:28/74 - (37%)
Similarity:40/74 - (54%) Gaps:7/74 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 SDLFGTSIGLDENANIV--DKYSDLLNVLGEMRTNVPTTMAGLRAPKERMQRDIAHARLKVRQCL 184
            ||....|:|..:...:.  ..||:||:|:.||...:..|.||.::..||::|.|.|||..||:||
Zfish    38 SDFGPPSMGFVQPVKVSQGSTYSELLSVIEEMSREIRPTYAGSKSAMERLKRGIIHARALVRECL 102

  Fly   185 QLLQQAEEE 193
                 ||.|
Zfish   103 -----AETE 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15142NP_609846.1 CDK2AP 1..192 CDD:286844 26/71 (37%)
cdk2ap2NP_001009898.1 CDK2AP <58..110 CDD:313096 24/54 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22607
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.