DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15142 and cdk2ap2

DIOPT Version :10

Sequence 1:NP_609846.1 Gene:CG15142 / 35059 FlyBaseID:FBgn0032645 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001009898.1 Gene:cdk2ap2 / 494160 ZFINID:ZDB-GENE-040718-35 Length:111 Species:Danio rerio


Alignment Length:74 Identity:28/74 - (37%)
Similarity:40/74 - (54%) Gaps:7/74 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 SDLFGTSIGLDENANIV--DKYSDLLNVLGEMRTNVPTTMAGLRAPKERMQRDIAHARLKVRQCL 184
            ||....|:|..:...:.  ..||:||:|:.||...:..|.||.::..||::|.|.|||..||:||
Zfish    38 SDFGPPSMGFVQPVKVSQGSTYSELLSVIEEMSREIRPTYAGSKSAMERLKRGIIHARALVRECL 102

  Fly   185 QLLQQAEEE 193
                 ||.|
Zfish   103 -----AETE 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15142NP_609846.1 CDK2AP 1..192 CDD:430840 26/71 (37%)
cdk2ap2NP_001009898.1 CDK2AP <58..110 CDD:430840 24/54 (44%)

Return to query results.
Submit another query.