DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15142 and CDK2AP1

DIOPT Version :9

Sequence 1:NP_609846.1 Gene:CG15142 / 35059 FlyBaseID:FBgn0032645 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001259439.1 Gene:CDK2AP1 / 32050 FlyBaseID:FBgn0030269 Length:295 Species:Drosophila melanogaster


Alignment Length:289 Identity:73/289 - (25%)
Similarity:122/289 - (42%) Gaps:98/289 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDYLDIESFRSRYSDITVTAVPSRPKADEEPAMDTNQELAIKTHVPQVEITRV----SGAASAGS 61
            ||.:||::..|:.||:|||.:   |::..:...:..|:...:...||::|:.:    ......|.
  Fly     1 MDIMDIQAVESKLSDVTVTPI---PRSQVQNFYNYQQQREQREQQPQIQISAIHHSRGSVGGGGG 62

  Fly    62 SSTANAAMML-------RNRQQT------------NSAALAYANEYKEVMAKLEYT-KYMQAQLQ 106
            |:::|||...       |.|.::            :|||.|.|......:|.|:|: :::||||.
  Fly    63 SNSSNAATDYSTSSGGKRERDRSSASDYSSSSSKQSSAAAANAAAAAAAVAALQYSPQFLQAQLA 127

  Fly   107 I-----------------------MSAANGG--GGGFGIDSDLFGT---SIGLD----------- 132
            :                       |.::|||  ..|.|:.|...|:   |:||:           
  Fly   128 LLQQQSNTTATPAAVAAAALSLANMCSSNGGQRNSGAGVSSTSSGSNGQSMGLNLSSSQLKYPPP 192

  Fly   133 ----------ENANI------------------VDKYSDLLNVLGEMRTNVPTTMAGLRAPKERM 169
                      .:|||                  :.||:.||.|:.||..::..|..|.|:..||:
  Fly   193 STSPVVVTTQTSANITTPLTSTASLPSVGPGNGLTKYAQLLAVIEEMGRDIRPTYTGSRSSTERL 257

  Fly   170 QRDIAHARLKVRQCL----QLLQQAEEET 194
            :|.|.|||:.||:||    :..:| |||:
  Fly   258 KRGIVHARILVRECLMETERAARQXEEES 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15142NP_609846.1 CDK2AP 1..192 CDD:286844 70/285 (25%)
CDK2AP1NP_001259439.1 CDK2AP 1..280 CDD:286844 69/281 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4713
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22607
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.