DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15142 and Y43F4B.10

DIOPT Version :10

Sequence 1:NP_609846.1 Gene:CG15142 / 35059 FlyBaseID:FBgn0032645 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_741280.1 Gene:Y43F4B.10 / 176752 WormBaseID:WBGene00012807 Length:108 Species:Caenorhabditis elegans


Alignment Length:56 Identity:18/56 - (32%)
Similarity:30/56 - (53%) Gaps:5/56 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 YSDLLNVLGEMRTNVPTTMAGLRAPKERMQRDIAHARLKVRQCLQLLQQAEEETDQ 196
            |..||.::.|:..:|..|....:...||::|:|..|::.:|.|     |.|.|||:
 Worm    26 YEVLLKLIEEIGKDVRPTYTFNKLTCERLKRNIQAAKVLIRAC-----QQEAETDK 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15142NP_609846.1 CDK2AP 1..192 CDD:430840 14/50 (28%)
Y43F4B.10NP_741280.1 CDK2AP <26..77 CDD:430840 18/56 (32%)

Return to query results.
Submit another query.