powered by:
Protein Alignment CG15142 and CDK2AP2
DIOPT Version :9
Sequence 1: | NP_609846.1 |
Gene: | CG15142 / 35059 |
FlyBaseID: | FBgn0032645 |
Length: | 206 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_005842.1 |
Gene: | CDK2AP2 / 10263 |
HGNCID: | 30833 |
Length: | 126 |
Species: | Homo sapiens |
Alignment Length: | 53 |
Identity: | 24/53 - (45%) |
Similarity: | 33/53 - (62%) |
Gaps: | 5/53 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 141 YSDLLNVLGEMRTNVPTTMAGLRAPKERMQRDIAHARLKVRQCLQLLQQAEEE 193
|:|||:|:.||...:..|.||.::..||::|.|.|||..||:|| ||.|
Human 74 YTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECL-----AETE 121
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4713 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR22607 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.870 |
|
Return to query results.
Submit another query.