DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5131 and ATP23

DIOPT Version :9

Sequence 1:NP_609845.1 Gene:CG5131 / 35057 FlyBaseID:FBgn0032644 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_150592.1 Gene:ATP23 / 91419 HGNCID:29452 Length:246 Species:Homo sapiens


Alignment Length:261 Identity:96/261 - (36%)
Similarity:147/261 - (56%) Gaps:33/261 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ITGAAQEKQNAKTEKASASKETSTEETTTAQKDWGYDLYPERRGETFKPKWTRVLFGLEGQENID 85
            :.||..|::     :..|:.|...::..:.|      ::|||..:           |...|....
Human     1 MAGAPDERR-----RGPAAGEQLQQQHVSCQ------VFPERLAQ-----------GNPQQGFFS 43

  Fly    86 RF-----KCEENVYWCVKNGPLVKLMMGALKSSGCPIDLRRHISCEVCDPTVTGGYDPKLNQIVV 145
            .|     ||:..:...::..|.|||::.|:|.|||.::..||.|||.|:..|:||:|...:|||:
Human    44 SFFTSNQKCQLRLLKTLETNPYVKLLLDAMKHSGCAVNKDRHFSCEDCNGNVSGGFDASTSQIVL 108

  Fly   146 CQNMARNKSMVHGVLTHEMIHMFDYCNNDMD-FRNVDHLACTEIRAANLA-HCSFLSAMFQGDAS 208
            |||...|::.::.|:|||:||.||:|...:| |.|:.||||:|:|||||: .||.::.:|:   .
Human   109 CQNNIHNQAHMNRVVTHELIHAFDHCRAHVDWFTNIRHLACSEVRAANLSGDCSLVNEIFR---L 170

  Fly   209 PFNVKEAHQNCVKSKALASVLAVRNISKADAVAAVERVFPKCYADLEPIGRRIRRNSTDQQKAYM 273
            .|.:|:.||.||:.:|..|:||||||||..|..||:.||..|:.|.||.| ||..|.|..:.|:.
Human   171 HFGLKQHHQTCVRDRATLSILAVRNISKEVAKKAVDEVFESCFNDHEPFG-RIPHNKTYARYAHR 234

  Fly   274 E 274
            :
Human   235 D 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5131NP_609845.1 Peptidase_M76 88..258 CDD:286809 78/171 (46%)
ATP23NP_150592.1 Peptidase_M76 50..220 CDD:313061 78/172 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159511
Domainoid 1 1.000 158 1.000 Domainoid score I4121
eggNOG 1 0.900 - - E1_KOG3314
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41699
Inparanoid 1 1.050 164 1.000 Inparanoid score I4202
Isobase 1 0.950 - 0 Normalized mean entropy S3406
OMA 1 1.010 - - QHG55218
OrthoDB 1 1.010 - - D1288109at2759
OrthoFinder 1 1.000 - - FOG0005453
OrthoInspector 1 1.000 - - oto90560
orthoMCL 1 0.900 - - OOG6_102968
Panther 1 1.100 - - LDO PTHR21711
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R114
SonicParanoid 1 1.000 - - X3877
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.