DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5131 and atp23

DIOPT Version :9

Sequence 1:NP_609845.1 Gene:CG5131 / 35057 FlyBaseID:FBgn0032644 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001025602.1 Gene:atp23 / 594990 XenbaseID:XB-GENE-971247 Length:235 Species:Xenopus tropicalis


Alignment Length:234 Identity:94/234 - (40%)
Similarity:138/234 - (58%) Gaps:15/234 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 EETTTAQKDWGYDLYPERRGETFKPK--WTRVLFGLEGQENIDRFKCEENVYWCVKNGPLVKLMM 107
            ||....|.:.||.|:|||.....|.:  .::.||..       ..||:..:...:...|..||::
 Frog     2 EEKKIEQDELGYQLFPERGNGDRKKQGLLSKSLFTF-------NHKCQVMLKIALDTSPYAKLLL 59

  Fly   108 GALKSSGCPIDLRRHISCEVCDPTVTGGYDPKLNQIVVCQNMARNKSMVHGVLTHEMIHMFDYCN 172
            .|:|.:||.:...||.|||.||.:|:||:|...::||:|||....:|.::.|:|||:||.||:|.
 Frog    60 DAMKHTGCTVYKDRHFSCEECDGSVSGGFDAATSEIVLCQNNIHQQSHMNRVVTHELIHAFDHCR 124

  Fly   173 NDMD-FRNVDHLACTEIRAANLA-HCSFLSAMFQGDASPFNVKEAHQNCVKSKALASVLAVRNIS 235
            ..:| |.||.||||:|||||||: .|:..:.:.:   ..|.|||.|:.||:.:||.|:|||||:|
 Frog   125 AHVDWFNNVRHLACSEIRAANLSGDCTLANELTR---FKFGVKEHHKVCVRDRALRSILAVRNVS 186

  Fly   236 KADAVAAVERVFPKCYADLEPIGRRIRRNSTDQQKAYME 274
            :..|..||:.||..|:.|.||.| ||..:.||.:.|:.:
 Frog   187 RETAEKAVDEVFDSCFNDHEPFG-RIPHSKTDAKFAHRD 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5131NP_609845.1 Peptidase_M76 88..258 CDD:286809 76/171 (44%)
atp23NP_001025602.1 Peptidase_M76 40..209 CDD:370674 76/171 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 151 1.000 Domainoid score I4325
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41699
Inparanoid 1 1.050 165 1.000 Inparanoid score I4070
OMA 1 1.010 - - QHG55218
OrthoDB 1 1.010 - - D1288109at2759
OrthoFinder 1 1.000 - - FOG0005453
OrthoInspector 1 1.000 - - oto104360
Panther 1 1.100 - - LDO PTHR21711
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R114
SonicParanoid 1 1.000 - - X3877
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.