DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GCS2beta and GNPTG

DIOPT Version :9

Sequence 1:NP_001246063.1 Gene:GCS2beta / 35056 FlyBaseID:FBgn0032643 Length:548 Species:Drosophila melanogaster
Sequence 2:XP_016879271.1 Gene:GNPTG / 84572 HGNCID:23026 Length:321 Species:Homo sapiens


Alignment Length:143 Identity:39/143 - (27%)
Similarity:60/143 - (41%) Gaps:30/143 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   431 VH----DGQCYNFEDREYVYTLCPFDRASQKSR-------SGGPETTLGRWDKWSGEPKQYSQQK 484
            ||    .|:|::..:..|.|..|||...:|..:       ||    .||.|.:|......::...
Human    78 VHLFRLSGKCFSLVESTYKYEFCPFHNVTQHEQTFRWNAYSG----ILGIWHEWEIANNTFTGMW 138

  Fly   485 YTNGAACWNGPNRSAIINISCALEPKITAVSEPNRCEYYFEFETPAACD----------SEAFQS 539
            ..:|.|| ...:|.:.:.::|....::..||||:.|.|...||||..|.          .||.|.
Human   139 MRDGDAC-RSRSRQSKVELACGKSNRLAHVSEPSTCVYALTFETPLVCHPHALLVYPTLPEALQR 202

  Fly   540 E----SENLHDEL 548
            :    .::|.|||
Human   203 QWDQVEQDLADEL 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GCS2betaNP_001246063.1 PRKCSH-like 26..193 CDD:193472
LDLa 85..120 CDD:238060
PRKCSH 398..547 CDD:297835 36/140 (26%)
GNPTGXP_016879271.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2397
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D632472at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.