DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GCS2beta and gnptg

DIOPT Version :10

Sequence 1:NP_609844.1 Gene:GCS2beta / 35056 FlyBaseID:FBgn0032643 Length:548 Species:Drosophila melanogaster
Sequence 2:XP_012825822.2 Gene:gnptg / 496836 XenbaseID:XB-GENE-945801 Length:302 Species:Xenopus tropicalis


Alignment Length:136 Identity:41/136 - (30%)
Similarity:57/136 - (41%) Gaps:26/136 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   434 GQCYNFEDREYVYTLCPFDRASQKSR-------SGGPETTLGRWDKWSGEPKQYSQQKYTNGAAC 491
            |:|:|..:..|.|.||||...:|..:       ||    .||.|.:|..|...:|......|.:|
 Frog    64 GKCFNLVESTYKYELCPFHNVTQHEQTFRWNAYSG----ILGIWQEWGIENNTFSGMWMREGDSC 124

  Fly   492 WNGPNRSAIINISCALEPKITAVSEPNRCEYYFEFETPAACD--------------SEAFQSESE 542
            .| .||...:.:.|....|::.||||:.|.|...||||..|.              .|.:....:
 Frog   125 GN-KNRQTKVLLVCGKVHKLSRVSEPSTCVYSLTFETPLVCHPHSLLVYPTLSEDLREKWNEAEQ 188

  Fly   543 NLHDEL 548
            .|:|||
 Frog   189 ALYDEL 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GCS2betaNP_609844.1 PRKCSH-like 26..193 CDD:372423
SMC_prok_B <154..428 CDD:274008
PRKCSH 398..547 CDD:414904 38/133 (29%)
gnptgXP_012825822.2 PRKCSH 64..124 CDD:400321 19/63 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.