DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GCS2beta and CG7685

DIOPT Version :9

Sequence 1:NP_001246063.1 Gene:GCS2beta / 35056 FlyBaseID:FBgn0032643 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_650724.1 Gene:CG7685 / 42220 FlyBaseID:FBgn0038619 Length:213 Species:Drosophila melanogaster


Alignment Length:105 Identity:51/105 - (48%)
Similarity:64/105 - (60%) Gaps:9/105 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GVPLAKASLYQPRAGENSWTCLDGSRTIPFSHINDDYCDC-ADGSDEPGTAACPQGQFHC-VNKG 96
            |..|.....|:|.. |..:.|||||:.|||.|:||:|||| .||||||.|.||.:|:|:| ..|.
  Fly   109 GTRLFDYDAYKPNF-EGKFRCLDGSKEIPFDHLNDNYCDCEEDGSDEPSTNACAKGRFYCRYQKR 172

  Fly    97 H-----QPVNIPSSQVQDGICDCCDGSDE-SETVGCPNTC 130
            |     ..:.:.||::.|.:||||||||| |....|||.|
  Fly   173 HITGRGLDIYVASSRINDHVCDCCDGSDEWSTATKCPNDC 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GCS2betaNP_001246063.1 PRKCSH-like 26..193 CDD:193472 51/105 (49%)
LDLa 85..120 CDD:238060 16/40 (40%)
PRKCSH 398..547 CDD:297835
CG7685NP_650724.1 PRKCSH-like 97..>213 CDD:193472 51/105 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448402
Domainoid 1 1.000 84 1.000 Domainoid score I1912
eggNOG 1 0.900 - - E1_KOG2397
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.859108 Normalized mean entropy S3335
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D145182at6960
OrthoFinder 1 1.000 - - FOG0003054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12630
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R500
SonicParanoid 00.000 Not matched by this tool.
98.830

Return to query results.
Submit another query.