DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GCS2beta and gnptg

DIOPT Version :9

Sequence 1:NP_001246063.1 Gene:GCS2beta / 35056 FlyBaseID:FBgn0032643 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_001002057.2 Gene:gnptg / 415147 ZFINID:ZDB-GENE-040625-18 Length:299 Species:Danio rerio


Alignment Length:120 Identity:38/120 - (31%)
Similarity:53/120 - (44%) Gaps:7/120 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   434 GQCYNFEDREYVYTLCPFDRASQKSRS---GGPETTLGRWDKWSGEPKQYSQQKYTNGAACWNGP 495
            |:|:|:.:..|.|..|||...:|..:|   ......||.|.:|..|...::......|.:|.| .
Zfish    67 GKCFNYIEATYKYVFCPFHNVTQHEQSFRWNAYSGILGIWHEWEIENNTFTGMWMREGDSCGN-K 130

  Fly   496 NRSAIINISCALEPKITAVSEPNRCEYYFEFETPAACDSEA---FQSESENLHDE 547
            ||...:.:.|....|:..||||..|.|...||||..|.|.:   :...||.|..|
Zfish   131 NRQTKVLLVCGSSSKLAGVSEPQTCVYSLTFETPLVCHSHSLLVYPVLSEKLQKE 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GCS2betaNP_001246063.1 PRKCSH-like 26..193 CDD:193472
LDLa 85..120 CDD:238060
PRKCSH 398..547 CDD:297835 37/118 (31%)
gnptgNP_001002057.2 PRKCSH 67..127 CDD:285195 16/59 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2397
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D632472at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.