DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GCS2beta and Gnptg

DIOPT Version :9

Sequence 1:NP_001246063.1 Gene:GCS2beta / 35056 FlyBaseID:FBgn0032643 Length:548 Species:Drosophila melanogaster
Sequence 2:XP_006245997.1 Gene:Gnptg / 287134 RGDID:1311614 Length:318 Species:Rattus norvegicus


Alignment Length:136 Identity:38/136 - (27%)
Similarity:59/136 - (43%) Gaps:26/136 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   434 GQCYNFEDREYVYTLCPFDRASQKSR-------SGGPETTLGRWDKWSGEPKQYSQQKYTNGAAC 491
            |:|::..:..|.|..|||...:|..:       ||    .||.|.:|......:.....|:|.:|
  Rat    69 GKCFSLVESTYKYEFCPFHNVTQHEQTFRWNAYSG----ILGIWHEWEIVNNTFKGMWMTDGDSC 129

  Fly   492 WNGPNRSAIINISCALEPKITAVSEPNRCEYYFEFETPAACD----------SEAFQSE----SE 542
             :..:|.:.:.::|....::..||||:.|.|...||||..|.          |||.|..    .:
  Rat   130 -HSRSRQSKVELTCGKTNRLAHVSEPSTCVYALTFETPLVCHPHSLLVYPTLSEALQQRWDQVEQ 193

  Fly   543 NLHDEL 548
            :|.|||
  Rat   194 DLADEL 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GCS2betaNP_001246063.1 PRKCSH-like 26..193 CDD:193472
LDLa 85..120 CDD:238060
PRKCSH 398..547 CDD:297835 35/133 (26%)
GnptgXP_006245997.1 PRKCSH 69..129 CDD:285195 16/63 (25%)
DMAP_binding 178..>261 CDD:283995 8/22 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2397
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D632472at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.