DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5110 and Lamtor3

DIOPT Version :9

Sequence 1:NP_001246062.1 Gene:CG5110 / 35055 FlyBaseID:FBgn0032642 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_064304.1 Gene:Lamtor3 / 56692 MGIID:1929467 Length:124 Species:Mus musculus


Alignment Length:121 Identity:54/121 - (44%)
Similarity:85/121 - (70%) Gaps:0/121 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDDIKKYLDGLLQKVSGLYVIQITDRDGVPLLRVSQEKNVDFALMPSFIPTFTTACDQASKLGL 65
            |:||:|::|...|..|.||:.|.::||||||:::|:.:...:.||.|.|:.||..|.||.|||||
Mouse     1 MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDSAPEHALRPGFLSTFALATDQGSKLGL 65

  Fly    66 GRNKTIISMYSNYQVVQMNKLPLILTFVGAENCNTGHILALEHQVDGYLEDIKQAV 121
            .:||:||..|:.|||||.|:|||:::|:.:.:.|||.|::||.::....|::.:.|
Mouse    66 SKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELIKVV 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5110NP_001246062.1 MAPKK1_Int 3..121 CDD:312472 52/117 (44%)
Lamtor3NP_064304.1 MAPKK1_Int 3..121 CDD:312472 52/117 (44%)
Required for interaction with LAMTOR2. /evidence=ECO:0000269|PubMed:11266467 57..70 8/12 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845976
Domainoid 1 1.000 114 1.000 Domainoid score I6082
eggNOG 1 0.900 - - E1_2A8R2
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10539
Inparanoid 1 1.050 117 1.000 Inparanoid score I4797
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56159
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006856
OrthoInspector 1 1.000 - - oto94838
orthoMCL 1 0.900 - - OOG6_105971
Panther 1 1.100 - - LDO PTHR13378
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4633
SonicParanoid 1 1.000 - - X4950
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.