DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5110 and lamtor3

DIOPT Version :9

Sequence 1:NP_001246062.1 Gene:CG5110 / 35055 FlyBaseID:FBgn0032642 Length:124 Species:Drosophila melanogaster
Sequence 2:XP_005156611.1 Gene:lamtor3 / 553597 ZFINID:ZDB-GENE-050522-345 Length:138 Species:Danio rerio


Alignment Length:124 Identity:56/124 - (45%)
Similarity:88/124 - (70%) Gaps:0/124 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDDIKKYLDGLLQKVSGLYVIQITDRDGVPLLRVSQEKNVDFALMPSFIPTFTTACDQASKLGL 65
            |:|:::.||...|..|.||:.|.:|||||||:::|:.:...::||.|:|:.||..|.||.|||||
Zfish    15 MADNLRSYLYKQLPSVEGLHAIVVTDRDGVPVIKVANDNAPEYALRPAFLSTFALATDQGSKLGL 79

  Fly    66 GRNKTIISMYSNYQVVQMNKLPLILTFVGAENCNTGHILALEHQVDGYLEDIKQAVTEA 124
            .:||:||..|:.||:||.|:|||:::|:.:.|.|||.|.:||.::...:|:::|.|..|
Zfish    80 SKNKSIICYYNTYQIVQFNRLPLVISFIASSNANTGLIFSLEKELVPLIEELRQVVEVA 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5110NP_001246062.1 MAPKK1_Int 3..121 CDD:312472 53/117 (45%)
lamtor3XP_005156611.1 MAPKK1_Int 17..135 CDD:286067 53/117 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590688
Domainoid 1 1.000 121 1.000 Domainoid score I5656
eggNOG 1 0.900 - - E1_2A8R2
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10539
Inparanoid 1 1.050 124 1.000 Inparanoid score I4694
OMA 1 1.010 - - QHG56159
OrthoDB 1 1.010 - - D1525606at2759
OrthoFinder 1 1.000 - - FOG0006856
OrthoInspector 1 1.000 - - oto39342
orthoMCL 1 0.900 - - OOG6_105971
Panther 1 1.100 - - LDO PTHR13378
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4633
SonicParanoid 1 1.000 - - X4950
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.