DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5110 and lmtr-3

DIOPT Version :9

Sequence 1:NP_001246062.1 Gene:CG5110 / 35055 FlyBaseID:FBgn0032642 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001367011.1 Gene:lmtr-3 / 259649 WormBaseID:WBGene00007390 Length:145 Species:Caenorhabditis elegans


Alignment Length:110 Identity:28/110 - (25%)
Similarity:55/110 - (50%) Gaps:5/110 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DIKKYLDGLLQKVSGLYVIQITDRDGVPLLRVSQEKNVDFA-LMPSFIPTFTTACDQASKLGLGR 67
            ::::.|:.|:....|:..|.|||.||..:|.:.....:|.: .....|.:..|...|..||.:|.
 Worm     2 NVQQELEELMLTYEGVCAIFITDHDGGLILNIGLPSTLDNSRFRQQLIVSHVTTIPQIHKLDMGG 66

  Fly    68 NKTIISMYSNYQVV--QMNKLPLILTFVGAENCNTGHILALEHQV 110
            ::|..::|.::|:.  .::|...|:.  ...|.|||.:|:|..::
 Worm    67 HQTTFALYESHQIAVHSIDKYYFIVH--AGTNTNTGAMLSLREKL 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5110NP_001246062.1 MAPKK1_Int 3..121 CDD:312472 28/110 (25%)
lmtr-3NP_001367011.1 MAPKK1_Int 1..120 CDD:312472 28/110 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164092
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105971
Panther 1 1.100 - - LDO PTHR13378
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.