DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fws and COG5

DIOPT Version :9

Sequence 1:NP_001246059.1 Gene:fws / 35054 FlyBaseID:FBgn0024689 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_014347.1 Gene:COG5 / 855676 SGDID:S000004996 Length:403 Species:Saccharomyces cerevisiae


Alignment Length:375 Identity:79/375 - (21%)
Similarity:137/375 - (36%) Gaps:116/375 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SDDNDFTASMSHLTIGQQIQELSKQLQNTKEELHQQVRDKHGALLQQATHAGRFDAALNA-LAED 80
            :::||.|           |.:|:..|:....:||:              ...|.|..:|: ..|.
Yeast    34 TNNNDTT-----------ILDLNTPLKKLNYDLHE--------------IDSRIDQLMNSNPLEI 73

  Fly    81 VQRVRETGH---------------------RLKNQVDTQYQQVENQTQVLGRLHDVSHLLRSAGT 124
            ::.:.:..|                     ||||||...|::.......|.:::..|.|||.|..
Yeast    74 IELIYKNEHVNSTIVGELKPSLGYMNMSYDRLKNQVLDPYERARKVQLALSKVYQTSFLLRGALL 138

  Fly   125 LLSLTAKLKA--------TKDVLRLAEIHFELG-QLIEDKELKDIDFIQQERAYVISSAQKIRNL 180
            .:.|:.||.|        |...:.||.:|::|. .|.|:|.||.:..|:|....::|..::    
Yeast   139 YIHLSNKLNALSKTAQLSTSTAINLASLHYQLEITLEENKNLKSLRKIKQLDQDIVSPNKR---- 199

  Fly   181 TQMQLVTGLQERNENQVVNALKIFMNFNTLEKSLDNLLATFIADMEQSLKECFAGNDISVLNKSP 245
               :|:|.|..:...:.:|::||..|...:.:...:|......:.|            |.:||..
Yeast   200 ---ELITFLSLQMCKECLNSIKIKSNKEIISQLAYSLYLLSSQEFE------------SAINKIV 249

  Fly   246 THNVSKPAPSRGPGKTPQLTTTQNFRAKFWKSLHWL--LYDELFETCTQIKLLKTALEQI----- 303
            ..||               |.:....:|...|:...  .::|:.|....|.:|:|.|:.|     
Yeast   250 LSNV---------------TMSSQILSKILNSIRMFPDAFNEVVEKGYNIYILETLLQNIKTDNV 299

  Fly   304 -----------NQFG-----YTSESS--DQCIPQ-RFWQQVQQLLRKSFD 334
                       ::.|     |||..|  ....|: .||.:|....:|.||
Yeast   300 TNSSRSIAANKSRLGNLLSEYTSMKSKAGSGTPRDLFWSKVSSAFKKDFD 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fwsNP_001246059.1 COG5 10..132 CDD:192566 27/136 (20%)
COG5NP_014347.1 COG5 14..146 CDD:192566 27/136 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341575
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13228
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.