DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sgt and TAH1

DIOPT Version :10

Sequence 1:NP_609842.1 Gene:Sgt / 35052 FlyBaseID:FBgn0032640 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_009986.1 Gene:TAH1 / 850424 SGDID:S000000656 Length:111 Species:Saccharomyces cerevisiae


Alignment Length:91 Identity:32/91 - (35%)
Similarity:49/91 - (53%) Gaps:6/91 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 ESIKNEGNRLMKENKYNEALLQYNRAIAFDPKNPIFYCNRAAAHIRLGENERAVTDCKSALVYNN 181
            |..|.:||.|.|:..|.||:..|::.|...|:||:.|.|:|.|.|:|||..:|:..|:..|.|.:
Yeast     5 EKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRYTS 69

  Fly   182 N------YSKAYCRLGVAYSNMGNFE 201
            .      .||...||.:|...:|:.:
Yeast    70 TAEHVAIRSKLQYRLELAQGAVGSVQ 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SgtNP_609842.1 SGTA_dimer 7..>48 CDD:465168
TPR 116..>233 CDD:440225 32/91 (35%)
TPR repeat 116..144 CDD:276809 10/26 (38%)
TPR repeat 149..179 CDD:276809 13/29 (45%)
TPR repeat 184..212 CDD:276809 6/18 (33%)
TAH1NP_009986.1 TPR repeat 8..32 CDD:276809 9/23 (39%)
Spy <11..>66 CDD:443119 22/54 (41%)
TPR repeat 37..67 CDD:276809 13/29 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.